Protein

MCA_03811_1

Length
357 amino acids


Gene name: KRR1

Description: KRR1 small subunit processome component

Browser: contigC:1151768-1152842-

RNA-seq: read pairs 1508, FPKM 52.0, percentile rank 66.2% (100% = highest expression)

Protein function

Annotation:KRR1KRR1 small subunit processome component
KEGG:K06961KRR1 ribosomal RNA assembly protein
EGGNOG:0PFJPRequired for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly (By similarity)
SGD closest match:S000000564KRR1KRR1 small subunit processome component
CGD closest match:CAL0000200947KRR1KRR1 small subunit processome component

Protein alignments

%idAln lengthE-value
MIA_05267_180.81%2711e-145MIA_05267_1
A0A060SZT9_BLAAD75.37%2727e-134KRR1 small subunit processome component OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C06578g PE=3 SV=1
A0A167EIW5_9ASCO70.80%2744e-129KRR1 small subunit processome component OS=Sugiyamaella lignohabitans GN=KRR1 PE=3 SV=1
A0A0J9XIK3_GEOCN67.51%2778e-127KRR1 small subunit processome component OS=Geotrichum candidum GN=BN980_GECA21s00483g PE=3 SV=1
KRR1_YEAST68.25%2742e-126KRR1 small subunit processome component OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRR1 PE=1 SV=1
UniRef50_B3LU2568.25%2744e-123KRR1 small subunit processome component n=122 Tax=Eukaryota TaxID=2759 RepID=KRR1_YEAS1
A0A1E4TDJ3_9ASCO69.49%2721e-125Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_148655 PE=4 SV=1
A0A1E3PJ25_9ASCO70.59%2722e-123KRR1 small subunit processome component OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51457 PE=3 SV=1
Q59W63_CANAL66.30%2739e-122KRR1 small subunit processome component OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=KRR1 PE=3 SV=1
Q6BZW4_YARLI67.28%2725e-121KRR1 small subunit processome component OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F30393g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0072

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 357

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_03811_1
MPSLHNKPDDAKPWDDGTVDKWKIDPFNPEDNAGGPFCEESSFVTLFPKYRETYLQQIWSQVTQHLDKLGIASDLDLIEG
IMTVKTTRKTYDPVAILNARDLTKLLARSVPIEQALKVLQDDITCDIIKINGYCSNRDRFAKRRQRLLGPDGSTLKALEL
LTGCYILVQGNTVAAMGTYKGLKEIRRIVEDCMKNIHPIYHIKELMIKQKLAQKPELAKEDWSRFLPQFKKRNVARKKPK
NVKEKKPYTPFPPAPPLSKIDKEIESGEYFMKKSEKEKKRMDEKKEKAEIKKAEKKKERQKEFEAPEEPEYESTLKKKSK
KRSSDENENEGEKKKKSKKRSSESHSEKKSKKVKTDE

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0003723 RNA binding

Cellular Component

None predicted.