Protein
MCA_03773_1
Length
117 amino acids
Gene name: CMC1
Description: COX assembly mitochondrial protein
Browser: contigC:1042596-1043067+
RNA-seq: read pairs 1474, FPKM 154.3, percentile rank 85.2% (100% = highest expression)
Protein function
Annotation: | CMC1 | COX assembly mitochondrial protein | |
---|---|---|---|
KEGG: | K18171 | CMC1 | COX assembly mitochondrial protein 1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05108_1 | 65.91% | 88 | 7e-41 | MIA_05108_1 |
A0A0J9XF00_GEOCN | 64.47% | 76 | 2e-31 | Similar to Saccharomyces cerevisiae YKL137W CMC1 Evolutionarily conserved copper-binding protein of the mitochondrial intermembrane space OS=Geotrichum candidum GN=BN980_GECA11s01814g PE=4 SV=1 |
UniRef50_A0A0J9XF00 | 64.47% | 76 | 3e-28 | Similar to Saccharomyces cerevisiae YKL137W CMC1 Evolutionarily conserved copper-binding protein of the mitochondrial intermembrane space n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XF00_GEOCN |
A0A060TIA3_BLAAD | 47.50% | 80 | 3e-21 | ARAD1D37312p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D37312g PE=4 SV=1 |
A0A167EDN6_9ASCO | 43.21% | 81 | 2e-19 | COX assembly mitochondrial protein OS=Sugiyamaella lignohabitans GN=CMC1 PE=4 SV=1 |
A0A1E3PQX0_9ASCO | 28.40% | 81 | 6e-11 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48500 PE=4 SV=1 |
Q6C7C2_YARLI | 27.71% | 83 | 1e-10 | YALI0E02002p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E02002g PE=4 SV=1 |
A0A1E4TB76_9ASCO | 20.51% | 78 | 8e-07 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45384 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0611
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_03773_1 MSEQKSNTTTTTTTTTEDNKEHNVPLWFLAPAEEKTLLKEHQEWTEKQCETQYNEFAKCCKEFPLFFPWKCNEKKQAMID CVGHYGSPQMFEKAKERYIERKIQFRKEKDEKEQQQQ
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.