Protein
MCA_03766_1
Length
85 amino acids
Browser: contigC:1017022-1017768+
RNA-seq: read pairs 7993, FPKM 1148.4, percentile rank 96.9% (100% = highest expression)
Protein function
| KEGG: | K17784 | MINOS1 | mitochondrial inner membrane organizing system protein 1 |
|---|---|---|---|
| EGGNOG: | 0PQM9 | FG06697.1 | DUF543 domain protein |
| SGD closest match: | S000007547 | MIC10 | MICOS complex subunit MIC10 |
| CGD closest match: | CAL0000198244 | orf19.3782.2 | MICOS complex subunit MIC10 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03673_1 | 84.88% | 86 | 5e-47 | MIA_03673_1 |
| A0A060T6A0_BLAAD | 83.53% | 85 | 3e-46 | MICOS complex subunit MIC10 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B17556g PE=3 SV=1 |
| A0A0J9XA20_GEOCN | 78.57% | 84 | 4e-44 | MICOS complex subunit MIC10 OS=Geotrichum candidum GN=BN980_GECA06s04916g PE=3 SV=1 |
| A0A1E3PRB2_9ASCO | 86.30% | 73 | 2e-42 | MICOS complex subunit MIC10 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_54023 PE=3 SV=1 |
| A0A1D8PM81_CANAL | 70.45% | 88 | 3e-38 | MICOS complex subunit MIC10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3782.2 PE=3 SV=1 |
| Q6C8L2_YARLI | 79.71% | 69 | 1e-33 | MICOS complex subunit MIC10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D18744g PE=3 SV=1 |
| UniRef50_A5DHQ1 | 73.24% | 71 | 6e-29 | MICOS complex subunit MIC10 n=36 Tax=Saccharomycetales TaxID=4892 RepID=A5DHQ1_PICGU |
| MIC10_YEAST | 65.82% | 79 | 5e-32 | MICOS complex subunit MIC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIC10 PE=1 SV=1 |
| A0A1E4TKL4_9ASCO | 67.53% | 77 | 5e-31 | MICOS complex subunit MIC10 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_885 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0554
Protein family membership
- Protein of unknown function DUF543 (IPR007512)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_03766_1 MSTSPEQKQVTKSETLLNDKWDVVISNTLVKTGLGFGFGVVASVLFFKRKAFPVWLGIGFGAGRGYAEGDAIFRDTKAGV RTVKA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.