Protein

MCA_03720_1

Length
731 amino acids

Gene name: BRE1

Description: E3 ubiquitin-protein ligase BRE1

Browser: contigC:870708-872904+

RNA-seq: read pairs 1613, FPKM 27.2, percentile rank 49.9% (100% = highest expression)

Protein function

Annotation:BRE1E3 ubiquitin-protein ligase BRE1
KEGG:K10696BRE1 E3 ubiquitin-protein ligase BRE1 [EC:2.3.2.27]
EGGNOG:0PJ71BRE1E3 ubiquitin-protein ligase that mediates monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation (By similarity)
SGD closest match:S000002232BRE1E3 ubiquitin-protein ligase BRE1
CGD closest match:CAL0000187022BRE1E3 ubiquitin-protein ligase BRE1

Protein alignments

%idAln lengthE-value
MIA_04866_145.55%6960.0MIA_04866_1
A0A0J9XJT4_GEOCN41.95%7082e-162Similar to Saccharomyces cerevisiae YDL074C BRE1 E3 ubiquitin ligase OS=Geotrichum candidum GN=BN980_GECA23s00065g PE=4 SV=1
UniRef50_A0A0J9XJT441.95%7083e-159Similar to Saccharomyces cerevisiae YDL074C BRE1 E3 ubiquitin ligase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJT4_GEOCN
A0A060T4K2_BLAAD35.85%7032e-122ARAD1C41316p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C41316g PE=4 SV=1
A0A161HHN1_9ASCO34.65%7362e-118E3 ubiquitin-protein ligase BRE1 OS=Sugiyamaella lignohabitans GN=BRE1 PE=4 SV=1
A0A1E3PH48_9ASCO36.20%7212e-109BRE1-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52261 PE=4 SV=1
BRE1_YARLI31.18%7444e-83E3 ubiquitin-protein ligase BRE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BRE1 PE=3 SV=1
A0A1E4TCP3_9ASCO31.74%7126e-81Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_140604 PE=4 SV=1
BRE1_CANAL27.23%7169e-51E3 ubiquitin-protein ligase BRE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRE1 PE=3 SV=1
BRE1_YEAST31.39%3953e-44E3 ubiquitin-protein ligase BRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRE1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0214

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 100 200 300 400 500 600 731

Detailed signature matches

  1. Domain IPR013956
    E3 ubiquitin ligase, BRE1
    1. PF08647 (BRE1)
  2. Domain IPR013083
    Zinc finger, RING/FYVE/PHD-type
    1. G3DSA:3.30.40.10
  3. Domain IPR001841
    Zinc finger, RING-type
    1. SM00184 (ring_2)
    2. PS50089 (ZF_RING_2)
  4. SITE IPR017907
    Zinc finger, RING-type, conserved site
    1. PS00518 (ZF_RING_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.20.5.340
  3. G3DSA:1.20.5.50
  4. PF13920 (zf-C3HC4_3)
  5. SSF57850 (RING/U-box)
  6. cd16499 (RING-HC_BR...)
  7. mobidb-lite (disord...)

Residue annotation

  1. Zn binding site cd...

Protein sequence

>MCA_03720_1
MADRKRSAEISSPQSSSIEEQHTAKKALISGDHDKVAIVNNKKNPKSLPKGIIQGKLTPKAVRRFKGEALFRTLKAYSTE
SELYRSNANKAQKELDTLKRVFTVQQSWCDNLIDQIDIAIKNKKQLQIPGSAVRDNILLRIDATEDQIKEDELIQEFNKR
NDDLKEKIDELFVWDGSVGEVSDLKIQLSDAIKKLHEYESEYNKLQSDKKDLEAKLEDVTQKYLKTEKLYTRLKCPVTNA
VFSEGTAPSESDSAKGSETPKIEATSKETAQEVSSLKIQIDSLNELISKQNEQMKNQDSQIEALNEKIRDLSGRLYNLSE
SDLQQSDAYRSLRRKYEDMSYLVNQLESRISHYQREKSAMMEERVSFEEKINRDTQKQIDELQARLDKAESDVSRIRAAR
DDLLSSLNIKKAQESEKTKGFQEIKELAEMRQARINSLEQEIARIKETQPTSTEVKDDELDKLSIEELKKIVLKLKQENA
SLIEELPELEKAYNLAHEKASKKVTDLLERENKMSRLIAEKAKADEKYFGAMRSKDALNLEHQKVRHQLSKTAECVQQMK
EVERRQNMKISKLEQQKEELTRKLQSTEKHCTIAESKLSDAERRVDSLISYTNKLSDDFKREENTIKAERKAKRDLEQEI
AKLKKQLELQISANNSSGGSQNLSDVELQLREFRTMALCSVCSKNFKDTVIKVCGHTFCTECAEERLQVRLRKCPLCNKQ
YSYNDLIKICL

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.