Protein
MCA_03690_1
Length
229 amino acids
Gene name: MRPS18
Description: 37S ribosomal protein S18, mitochondrial
Browser: contigC:780822-781574-
RNA-seq: read pairs 3535, FPKM 189.9, percentile rank 87.5% (100% = highest expression)
Protein function
Annotation: | MRPS18 | 37S ribosomal protein S18, mitochondrial | |
---|---|---|---|
KEGG: | K02948 | RP-S11 | small subunit ribosomal protein S11 |
EGGNOG: | 0PQ9W | FG02762.1 | Ribosomal protein |
SGD closest match: | S000005250 | MRPS18 | 37S ribosomal protein S18, mitochondrial |
CGD closest match: | CAL0000201449 | orf19.688 | Mitochondrial 37S ribosomal protein YmS18 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03683_1 | 60.98% | 164 | 8e-68 | MIA_03683_1 |
A0A0J9XH89_GEOCN | 48.62% | 218 | 3e-64 | Similar to Saccharomyces cerevisiae YNL306W MRPS18 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA16s01396g PE=3 SV=1 |
UniRef50_A0A0J9XH89 | 48.62% | 218 | 6e-61 | Similar to Saccharomyces cerevisiae YNL306W MRPS18 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XH89_GEOCN |
A0A060T442_BLAAD | 49.39% | 164 | 3e-51 | ARAD1C01672p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C01672g PE=3 SV=1 |
A0A167FLY4_9ASCO | 48.17% | 164 | 9e-48 | Mitochondrial 37S ribosomal protein YmS18 OS=Sugiyamaella lignohabitans GN=MRPS18 PE=3 SV=1 |
A0A1E3PH07_9ASCO | 40.11% | 187 | 3e-36 | Translational machinery component (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47291 PE=4 SV=1 |
RT18_YEAST | 37.34% | 158 | 5e-31 | 37S ribosomal protein S18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS18 PE=1 SV=2 |
Q6C5Y2_YARLI | 33.73% | 166 | 2e-26 | YALI0E14124p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E14124g PE=3 SV=1 |
A0A1D8PPR6_CANAL | 30.58% | 206 | 8e-26 | Mitochondrial 37S ribosomal protein YmS18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.688 PE=4 SV=1 |
A0A1E4TBM0_9ASCO | 28.90% | 173 | 9e-20 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_20001 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9896
Predicted cleavage: 31
Protein family membership
- Ribosomal protein S11 (IPR001971)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
MF_01310 (Ribosomal...)
-

Unintegrated signatures
-
SSF53137 (Translati...)
Protein sequence
>MCA_03690_1 MLPITSRSLFAKRATTGLVSRAFSTSKQSLNFKTERITPTPFSLKSTDSSFSPIKSARLFDVQRVPSDGKVIVGYVLHCK FTRNNTLITLTSQYTPHPEGKLAKKMKPEELYLSLIRPQQEVKFTVTAGMVGFRHTKQGEYEAGFQTAAKVFQMIKDKEF LTKVPVKSKSMVQQRPLEIILSEFGKGREAFLNCLNSSEGNHIRPYVGRVTDGTKIKIGGVRPPRARRV
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome