Protein

MCA_03690_1

Length
229 amino acids


Gene name: MRPS18

Description: 37S ribosomal protein S18, mitochondrial

Browser: contigC:780822-781574-

RNA-seq: read pairs 3535, FPKM 189.9, percentile rank 87.5% (100% = highest expression)

Protein function

Annotation:MRPS1837S ribosomal protein S18, mitochondrial
KEGG:K02948RP-S11 small subunit ribosomal protein S11
EGGNOG:0PQ9WFG02762.1Ribosomal protein
SGD closest match:S000005250MRPS1837S ribosomal protein S18, mitochondrial
CGD closest match:CAL0000201449orf19.688Mitochondrial 37S ribosomal protein YmS18

Protein alignments

%idAln lengthE-value
MIA_03683_160.98%1648e-68MIA_03683_1
A0A0J9XH89_GEOCN48.62%2183e-64Similar to Saccharomyces cerevisiae YNL306W MRPS18 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA16s01396g PE=3 SV=1
UniRef50_A0A0J9XH8948.62%2186e-61Similar to Saccharomyces cerevisiae YNL306W MRPS18 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XH89_GEOCN
A0A060T442_BLAAD49.39%1643e-51ARAD1C01672p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C01672g PE=3 SV=1
A0A167FLY4_9ASCO48.17%1649e-48Mitochondrial 37S ribosomal protein YmS18 OS=Sugiyamaella lignohabitans GN=MRPS18 PE=3 SV=1
A0A1E3PH07_9ASCO40.11%1873e-36Translational machinery component (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47291 PE=4 SV=1
RT18_YEAST37.34%1585e-3137S ribosomal protein S18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS18 PE=1 SV=2
Q6C5Y2_YARLI33.73%1662e-26YALI0E14124p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E14124g PE=3 SV=1
A0A1D8PPR6_CANAL30.58%2068e-26Mitochondrial 37S ribosomal protein YmS18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.688 PE=4 SV=1
A0A1E4TBM0_9ASCO28.90%1739e-20Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_20001 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9896
Predicted cleavage: 31

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. MF_01310 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF53137 (Translati...)

Protein sequence

>MCA_03690_1
MLPITSRSLFAKRATTGLVSRAFSTSKQSLNFKTERITPTPFSLKSTDSSFSPIKSARLFDVQRVPSDGKVIVGYVLHCK
FTRNNTLITLTSQYTPHPEGKLAKKMKPEELYLSLIRPQQEVKFTVTAGMVGFRHTKQGEYEAGFQTAAKVFQMIKDKEF
LTKVPVKSKSMVQQRPLEIILSEFGKGREAFLNCLNSSEGNHIRPYVGRVTDGTKIKIGGVRPPRARRV

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome