Protein
MCA_03670_1
Length
94 amino acids
Description: Centromere protein X
Browser: contigC:738729-739014+
RNA-seq: read pairs 164, FPKM 21.3, percentile rank 43.0% (100% = highest expression)
Protein function
Annotation: | Centromere protein X |
---|
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XCS0_GEOCN | 35.48% | 93 | 4e-10 | Similar to Saccharomyces cerevisiae YDL160C-A MHF2 Component of the heterotetrameric MHF histone-fold complex OS=Geotrichum candidum GN=BN980_GECA09s03491g PE=4 SV=1 |
MIA_05745_1 | 28.26% | 92 | 4e-08 | MIA_05745_1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0234
Protein family membership
- Centromere protein X (IPR018552)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF09415 (CENP-X)
-

Unintegrated signatures
Protein sequence
>MCA_03670_1 MANNNGDDQSDIKFPINTLVRILKEEALQAPDKTKITKQAVEGLSQYLDVFVKEAIWRSYKQLEQEQLQGQQGEMALDID QLRAVSSNLVLDFL
GO term prediction
Biological Process
GO:0006281 DNA repair
GO:0051382 kinetochore assembly
Molecular Function
None predicted.
Cellular Component
None predicted.