Protein
MCA_03650_1
Length
429 amino acids
Gene name: RRD1
Description: Serine/threonine-protein phosphatase 2A activator 1
Browser: contigC:658879-660169+
RNA-seq: read pairs 815, FPKM 23.4, percentile rank 45.7% (100% = highest expression)
Protein function
| Annotation: | RRD1 | Serine/threonine-protein phosphatase 2A activator 1 | |
|---|---|---|---|
| KEGG: | K17605 | PPP2R4 | serine/threonine-protein phosphatase 2A activator |
| EGGNOG: | 0PJ68 | RRD1 | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for PP2A-like phosphatases modulating their activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2Ai) in presence of ATP and Mg(2 ) by dissociating the inactive form from the complex (By similarity) |
| SGD closest match: | S000001415 | RRD1 | Serine/threonine-protein phosphatase 2A activator 1 |
| CGD closest match: | CAL0000191133 | RRD1 | Serine/threonine-protein phosphatase 2A activator 1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05113_1 | 64.18% | 402 | 4e-171 | MIA_05113_1 |
| A0A0J9X469_GEOCN | 63.53% | 351 | 2e-149 | Serine/threonine-protein phosphatase 2A activator OS=Geotrichum candidum GN=BN980_GECA02s04135g PE=3 SV=1 |
| UniRef50_A0A0J9X469 | 63.53% | 351 | 4e-146 | Serine/threonine-protein phosphatase 2A activator n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X469_GEOCN |
| A0A060T902_BLAAD | 57.05% | 305 | 2e-106 | Serine/threonine-protein phosphatase 2A activator OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D15026g PE=3 SV=1 |
| PTPA1_YARLI | 50.90% | 334 | 5e-104 | Serine/threonine-protein phosphatase 2A activator 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRD1 PE=3 SV=1 |
| A0A167C0D2_9ASCO | 52.81% | 303 | 3e-100 | Serine/threonine-protein phosphatase 2A activator OS=Sugiyamaella lignohabitans GN=RRD1 PE=3 SV=1 |
| A0A1E3PKJ3_9ASCO | 48.17% | 301 | 3e-92 | Serine/threonine-protein phosphatase 2A activator OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83430 PE=3 SV=1 |
| PTPA1_YEAST | 43.90% | 328 | 2e-79 | Serine/threonine-protein phosphatase 2A activator 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRD1 PE=1 SV=1 |
| A0A1E4THH5_9ASCO | 44.59% | 314 | 1e-75 | Serine/threonine-protein phosphatase 2A activator OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_117630 PE=3 SV=1 |
| PTPA1_CANAL | 43.00% | 293 | 3e-70 | Serine/threonine-protein phosphatase 2A activator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRD1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5079
Predicted cleavage: 26
Protein family membership
- Phosphotyrosyl phosphatase activator, PTPA (IPR004327)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF016325 (PTPA)
-
cd04087 (PTPA)
-
PF03095 (PTPA)
-
no IPR
Unintegrated signatures
-
SSF140984 (PTPA-like)
-
mobidb-lite (disord...)
Residue annotation
-
peptide-induced di...
-
ATP binding site c...
-
putative interacti...
-
putative PP2A bind...
-
peptide binding po...
Protein sequence
>MCA_03650_1 MSNPTRLPSEIRIPPTGLPRPTPRTGPGSIPSNLLPGIASSPVTIAPNSQQPQTSVPDIPVIPDTPKDELIQQIKDAGFS TPVKCINAAVDVDSFTRHSRAYIRIVSLIRSISLKVSLKQLPESASCDSAIKITRILDKVDEIMETVPPLEGPRRFGNLA FRTFQDKLIKNADTFLQEILGKSKVLSPEQNPFIELTPYFLGSFGSRQRLDFGTGHELSFLAFFGGLCAIDLVEEDISGE DILFVFERYFNLIRKIIMKYSLEPAGSHGVWGLDDHFHLPYILGSAQIVDITQPDTPTPRFSPKTVLKRHFVERHRKTNL YFSAIAFINEVKKGPFHEHSPTLNDVAHVATWHKIHRGMVKMYIAEVLGKFPVVQHFYFGTGFYPWVDKNTGKKLPSTEI EENFETKSAAAMHLLNSHYLSDRPIGSNE
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0019211 phosphatase activator activity
Cellular Component
None predicted.