Protein

MCA_03636_1

Length
417 amino acids

Gene name: RPT3

Description: 26S proteasome regulatory subunit 6B homolog; ATPase of the 19S regulatory particle of the 26S proteasome

Browser: contigC:606248-607502-

RNA-seq: read pairs 5199, FPKM 153.7, percentile rank 85.2% (100% = highest expression)

Protein function

Annotation:RPT326S proteasome regulatory subunit 6B homolog; ATPase of the 19S regulatory particle of the 26S proteasome
KEGG:K03063PSMC4 26S proteasome regulatory subunit T3
EGGNOG:0PGYARPT326s protease regulatory subunit 6b
SGD closest match:S000002802RPT326S proteasome regulatory subunit 6B homolog
CGD closest match:CAL0000190759PR26Proteasome regulatory particle base subunit

Protein alignments

%idAln lengthE-value
A0A167DGP7_9ASCO89.65%4250.0Proteasome regulatory particle base subunit RPT3 OS=Sugiyamaella lignohabitans GN=RPT3 PE=3 SV=1
MIA_04178_190.48%4200.0MIA_04178_1
A0A0J9XIE4_GEOCN90.02%4210.0Similar to Saccharomyces cerevisiae YDR394W RPT3 One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates OS=Geotrichum candidum GN=BN980_GECA19s00164g PE=3 SV=1
A0A060SX47_BLAAD88.01%4170.0ARAD1A06204p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A06204g PE=3 SV=1
A0A1E3PHQ7_9ASCO88.34%4030.026S proteasome subunit P45 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_26234 PE=3 SV=1
Q6C9E8_YARLI89.37%3950.0YALI0D11770p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D11770g PE=3 SV=1
UniRef50_K1WRN186.28%4010.026S protease regulatory subunit 6B n=1 Tax=Marssonina brunnea f. sp. multigermtubi (strain MB_m1) TaxID=1072389 RepID=K1WRN1_MARBU
A0A1E4TI03_9ASCO83.10%4200.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3090 PE=3 SV=1
PRS6B_YEAST87.27%3850.026S proteasome regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2
Q5A0L8_CANAL84.30%4140.0Proteasome regulatory particle base subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PR26 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0156

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 417

Detailed signature matches

  1. Family IPR005937
    26S proteasome regulatory subunit P45-like
    1. TIGR01242
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR003593
    AAA+ ATPase domain
    1. SM00382 (AAA_5)
  4. Domain IPR003959
    ATPase, AAA-type, core
    1. PF00004 (AAA)
  5. SITE IPR003960
    ATPase, AAA-type, conserved site
    1. PS00674 (AAA)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.8.60
  3. G3DSA:3.40.50...
  4. cd00009 (AAA)
  5. mobidb-lite (disord...)

Residue annotation

  1. Walker A motif cd0...
  2. ATP binding site c...
  3. Walker B motif cd0...
  4. arginine finger cd...

Protein sequence

>MCA_03636_1
MEVLGISPAQLKEPVGPSSVSEGISTQSNETSSKDKYLQLKKLERQYELLNLQEEYIKDEQRHLKRELVRAQEEVKRIQS
VPLVIGQFLEPIDQHTGIVASTTGSNYSVRILSTLDRELLKPSSSVALHRHSNALVDILPPEADSSIAMLGADEKPNVTY
ADVGGLDMQKQEIREAVELPLTQFELYKQIGIDPPRGVLLYGPPGTGKTMLVKAVANSSTASFIRVVGSEFVQKYLGEGP
RMVRDVFRLARENAPSIIFIDEIDSIATKRFDAQTGADREVQRILLELLNQMDGFDQSANVKVIMATNRADTLDPALLRP
GRLDRKIEFPSLRDRRERRLIFTTIASKMSLAPEVDLDSLIVRNDPLSGAIIAAIMQEAGLRAVRKNRYVILQSDLEEAY
SSQVKVGSDVDKFDFYK

GO term prediction

Biological Process

GO:0030163 protein catabolic process

Molecular Function

GO:0005524 ATP binding
GO:0016787 hydrolase activity

Cellular Component

GO:0005737 cytoplasm