Protein
MCA_03616_1
Length
137 amino acids
Browser: contigC:551268-552153+
RNA-seq: read pairs 33177, FPKM 2970.6, percentile rank 98.4% (100% = highest expression)
Protein function
| KEGG: | K02894 | RP-L23e | large subunit ribosomal protein L23e |
|---|---|---|---|
| EGGNOG: | 0PMYQ | FG00802.1 | 60s ribosomal protein l23 |
| SGD closest match: | S000000183 | RPL23A | 60S ribosomal protein L23-A |
| CGD closest match: | CAL0000187999 | RPL23A | Ribosomal 60S subunit protein L23B |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03788_1 | 97.81% | 137 | 8e-95 | MIA_03788_1 |
| A0A0F7RRM8_GEOCN | 94.16% | 137 | 5e-92 | Similar to Saccharomyces cerevisiae YBL087C RPL23A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA04s06379g PE=3 SV=1 |
| A0A1D8PPT5_CANAL | 86.86% | 137 | 4e-86 | Ribosomal 60S subunit protein L23B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL23A PE=3 SV=1 |
| A0A1E4T9M2_9ASCO | 91.60% | 131 | 1e-85 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_146828 PE=3 SV=1 |
| A0A060TFM7_BLAAD | 89.31% | 131 | 1e-84 | ARAD1D16324p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D16324g PE=3 SV=1 |
| Q6C9L1_YARLI | 88.81% | 134 | 2e-84 | YALI0D10263p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D10263g PE=3 SV=1 |
| RL23A_YEAST | 84.67% | 137 | 1e-82 | 60S ribosomal protein L23-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL23A PE=1 SV=1 |
| UniRef50_P0CX41 | 84.67% | 137 | 3e-79 | 60S ribosomal protein L23-A n=239 Tax=cellular organisms TaxID=131567 RepID=RL23A_YEAST |
| A0A167E126_9ASCO | 92.00% | 125 | 3e-81 | Ribosomal 60S subunit protein L23B OS=Sugiyamaella lignohabitans GN=RPL23B PE=3 SV=1 |
| A0A1E3PQT6_9ASCO | 90.43% | 115 | 3e-73 | Ribosomal protein L14b/L23e OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81812 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4611
Predicted cleavage: 50
Protein family membership
- Ribosomal protein L14P (IPR000218)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_03616_1 MSGSGVSGNKYRMSLGLPVGAIINCCDNSGARNLSIIAVKGFGARLNRLPSAGVGDMVMATVKKGKPELRKKVMPAIVVR QSKPWRRKDGIHLYFEDNAGVIVNPKGEMKGSAITGPVGKECADLWPRIASNSGVVV
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome