Protein

MCA_03547_1

Length
314 amino acids


Browser: contigC:286285-287696-

RNA-seq: read pairs 1737, FPKM 68.1, percentile rank 72.0% (100% = highest expression)

Protein function

KEGG:K00797speE spermidine synthase [EC:2.5.1.16]
EGGNOG:0PHI1PGUG_05047Spermidine synthase
SGD closest match:S000006273SPE3Spermidine synthase
CGD closest match:CAL0000181339SPE3Spermidine synthase

Protein alignments

%idAln lengthE-value
MIA_05023_173.29%3223e-160MIA_05023_1
A0A0J9XHU3_GEOCN66.56%3113e-135Similar to Saccharomyces cerevisiae YPR069C SPE3 Spermidine synthase involved in biosynthesis of spermidine and also in biosynthesis of pantothenic acid OS=Geotrichum candidum GN=BN980_GECA15s02364g PE=3 SV=1
A0A1E4TAF4_9ASCO63.23%3102e-131Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_127935 PE=3 SV=1
UniRef50_Q9Y8H760.26%3124e-127Spermidine synthase n=156 Tax=Eukaryota TaxID=2759 RepID=SPEE_NEUCR
A0A060T393_BLAAD61.22%3122e-128ARAD1A07832p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07832g PE=3 SV=1
A0A167F5P8_9ASCO59.94%3121e-125Spermidine synthase OS=Sugiyamaella lignohabitans GN=SPE3 PE=3 SV=1
Q6C3P7_YARLI59.03%3102e-122YALI0E33143p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E33143g PE=3 SV=1
A0A1E3PJN9_9ASCO57.69%3121e-121Spermine synthase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50916 PE=3 SV=1
SPEE_YEAST58.12%3083e-117Spermidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE3 PE=1 SV=1
Q59Z50_CANAL57.19%3133e-117Spermidine synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPE3 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0239

Protein family membership

Domains and repeats

1 50 100 150 200 250 314

Detailed signature matches

    1. MF_00198 (Spermidin...)
    1. PF17284 (Spermine_s...)
    1. SSF53335 (S-adenosy...)
    1. PS51006 (PABS_2)
    1. PS01330 (PABS_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PF01564 (Spermine_s...)
  2. cd02440 (AdoMet_MTases)

Residue annotation

  1. S-adenosylmethioni...

Protein sequence

>MCA_03547_1
MTVEELSHPTIKDGWFVEENDEWPGQALRLKVKKILHVEKSQYQDVLVFESTNHGNVLVLDGVIQVSESDEFAYQEMLSH
LALNSHPNPRRVLVIGGGDGGVLREIVKHECVEQVVLVEIDEAVIRVSKQYLPEMASAFDHPKVKVQVGDGFKYLEQVSK
LSRLARESNKEKEENYRDDHLFDVIITDSSDPEGPAQQLFQKDFYNLLYNALTPDGIMSCQVSENQWLNLQLIQRLKTSC
KTVFPVVEYSYVCVPTYTSGQLGLFVCSKNPNVNVKIPVRTWPKEQEETINKYYNKEMHTASFVLPTWARDILK

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003824 catalytic activity

Cellular Component

None predicted.