Protein
MCA_03493_1
Length
224 amino acids
Gene name: MAD2
Description: Mitotic spindle checkpoint component MAD2
Browser: contigC:118934-119677+
RNA-seq: read pairs 184, FPKM 10.1, percentile rank 26.1% (100% = highest expression)
Protein function
Annotation: | MAD2 | Mitotic spindle checkpoint component MAD2 | |
---|---|---|---|
KEGG: | K02537 | MAD2 | mitotic spindle assembly checkpoint protein MAD2 |
EGGNOG: | 0PFQB | MAD2 | mitotic spindle checkpoint component MAD2 |
SGD closest match: | S000003567 | MAD2 | Mitotic spindle checkpoint component MAD2 |
CGD closest match: | CAL0000196404 | MAD2 | Spindle assembly checkpoint component MAD2 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01924_1 | 74.43% | 219 | 3e-105 | MIA_01924_1 |
A0A0J9XL33_GEOCN | 70.51% | 217 | 2e-99 | Similar to Saccharomyces cerevisiae YJL030W MAD2 Component of the spindle-assembly checkpoint complex OS=Geotrichum candidum GN=BN980_GECA25s00912g PE=4 SV=1 |
A0A060T8Y5_BLAAD | 70.62% | 211 | 3e-95 | ARAD1D06754p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D06754g PE=4 SV=1 |
Q6C600_YARLI | 63.68% | 212 | 2e-86 | YALI0E13684p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E13684g PE=4 SV=1 |
A0A1E3PM88_9ASCO | 60.45% | 220 | 8e-82 | Mitotic spindle checkpoint protein MAD2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_70282 PE=4 SV=1 |
UniRef50_A0A0A2KV75 | 60.09% | 213 | 2e-74 | DNA-binding HORMA n=82 Tax=Fungi TaxID=4751 RepID=A0A0A2KV75_PENEN |
A0A167D4F6_9ASCO | 64.63% | 164 | 4e-60 | Spindle checkpoint protein MAD2 OS=Sugiyamaella lignohabitans GN=MAD2 PE=4 SV=1 |
MAD2_YEAST | 47.12% | 208 | 2e-58 | Mitotic spindle checkpoint component MAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAD2 PE=1 SV=1 |
MAD2_CANAL | 43.06% | 209 | 7e-48 | Spindle assembly checkpoint component MAD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAD2 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7869
Predicted cleavage: 26
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
224
Detailed signature matches

Unintegrated signatures
Protein sequence
>MCA_03493_1 MSTKQSSMISAPTRSKVALKGSSRTVAEFFEYSINSILYQRGIYPPEDFQMVRKYNLNVLVTLDSEVKSYIKKIIGQLHK WLLHGKIKKLVVVIVSKNSGETIEKWQFDVNILNNSSSSSSSSSSSQSNNNNIQEKSDEIIQKEIQAIIRQITASITFLP VLDPGDCTFNVQVYADSDAQVPVEWADSEARDVKNAEQVQLRSFSTNSHEINTLVAYRLGGNDD
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.