Protein

MCA_03445_2

Length
172 amino acids


Browser: contigB:4440960-4441751+

RNA-seq: read pairs 56868, FPKM 4061.6, percentile rank 99.1% (100% = highest expression)

Protein function

KEGG:K02882RP-L18Ae large subunit ribosomal protein L18Ae
EGGNOG:0PJYURPL2060s ribosomal protein l20
SGD closest match:S000005839RPL20B60S ribosomal protein L20-B
CGD closest match:CAL0000200399RPL20B60S ribosomal protein L20

Protein alignments

%idAln lengthE-value
MIA_05632_192.44%1726e-117MIA_05632_1
A0A0J9XFD0_GEOCN83.04%1712e-10560S ribosomal protein L20 OS=Geotrichum candidum GN=BN980_GECA13s01044g PE=3 SV=1
A0A060TB76_BLAAD82.46%1716e-10560S ribosomal protein L20 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D25762g PE=3 SV=1
Q6C0J5_YARLI74.27%1712e-9860S ribosomal protein L20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F24123g PE=3 SV=1
A0A1E3PFZ5_9ASCO75.60%1681e-9560S ribosomal protein L20 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_71509 PE=3 SV=1
UniRef50_A3GGB071.93%1713e-9060S ribosomal protein L20 n=117 Tax=Eukaryota TaxID=2759 RepID=A3GGB0_PICST
A0A1D8PLC9_CANAL71.35%1712e-9260S ribosomal protein L20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL20B PE=3 SV=1
RL20B_YEAST71.93%1716e-9260S ribosomal protein L20-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL20B PE=1 SV=1
A0A1E4TKZ0_9ASCO70.76%1711e-9060S ribosomal protein L20 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_86731 PE=3 SV=1
A0A161HHS4_9ASCO80.00%1451e-8460S ribosomal protein L20 OS=Sugiyamaella lignohabitans GN=RPL20B PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1586

Protein family membership

Domains and repeats

1 20 40 60 80 100 120 140 160 172

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF160374 (RplX-like)

Protein sequence

>MCA_03445_2
MGRLNEYQIIGRRLPSESEPEPKLYRMRIFAPNTVVAKSRFWYFLTKLRRIKKAAGEIVSVNLIHEKTPTKVKNFGIWIR
YDSRSGTHNMYKEYRELSRAAAVEALYQDMAARHRARFRSIHILKVAEIENVDDIKRQYIRQLTTPDLKFPLTHFVEKTN
ELFVTKRPATFN

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome