Protein
MCA_03432_1
Length
93 amino acids
Gene name: QCR8
Description: Cytochrome b-c1 complex subunit 8
Browser: contigB:4411617-4411986-
RNA-seq: read pairs 27656, FPKM 3635.3, percentile rank 98.9% (100% = highest expression)
Protein function
Annotation: | QCR8 | Cytochrome b-c1 complex subunit 8 | |
---|---|---|---|
KEGG: | K00418 | QCR8 | ubiquinol-cytochrome c reductase subunit 8 |
EGGNOG: | 0PPPU | QCR8 | Ubiquinol-cytochrome C reductase |
SGD closest match: | S000003702 | QCR8 | Cytochrome b-c1 complex subunit 8 |
CGD closest match: | CAL0000201360 | QCR8 | Ubiquinol--cytochrome-c reductase subunit 8 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04242_1 | 81.72% | 93 | 2e-52 | MIA_04242_1 |
A0A0J9XC74_GEOCN | 72.83% | 92 | 2e-47 | Similar to Saccharomyces cerevisiae YJL166W QCR8 Subunit 8 of ubiquinol cytochrome-c reductase complex OS=Geotrichum candidum GN=BN980_GECA07s04707g PE=4 SV=1 |
UniRef50_A0A0J9XC74 | 72.83% | 92 | 5e-44 | Similar to Saccharomyces cerevisiae YJL166W QCR8 Subunit 8 of ubiquinol cytochrome-c reductase complex n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XC74_GEOCN |
A0A1E3PDY6_9ASCO | 62.64% | 91 | 2e-37 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84573 PE=4 SV=1 |
QCR8_YEAST | 56.52% | 92 | 2e-35 | Cytochrome b-c1 complex subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR8 PE=1 SV=2 |
A0A060TGR0_BLAAD | 59.77% | 87 | 3e-34 | ARAD1D32736p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32736g PE=4 SV=1 |
Q6C387_YARLI | 56.47% | 85 | 2e-34 | YALI0F01771p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F01771g PE=4 SV=1 |
A0A1D8PHA2_CANAL | 57.30% | 89 | 1e-33 | Ubiquinol--cytochrome-c reductase subunit 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QCR8 PE=4 SV=1 |
A0A1E4TAB5_9ASCO | 48.81% | 84 | 4e-27 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_127883 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9093
Predicted cleavage: 28
Protein family membership
- Cytochrome b-c1 complex subunit 8 (IPR004205)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_03432_1 MAPPHGKTYLGWWGRLGSPPQKGIARYAVSGYSQKLFVGALHNAVFNTFRRVKNQIFFIAFPISIYYYIWTSAQDYNHWL YTKAGRETLEKLV
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0008121 ubiquinol-cytochrome-c reductase activity
Cellular Component
None predicted.