Protein
MCA_03391_1
Length
620 amino acids
Gene name: DPH2
Description: 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2
Browser: contigB:4302555-4304418-
RNA-seq: read pairs 544, FPKM 10.8, percentile rank 27.2% (100% = highest expression)
Protein function
| Annotation: | DPH2 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 | |
|---|---|---|---|
| KEGG: | K17866 | DPH2 | diphthamide biosynthesis protein 2 |
| EGGNOG: | 0PH60 | DPH2 | Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L- methionine to a histidine residue. Diphthamide is a post- translational modification of histidine which occurs in elongation factor 2 |
| SGD closest match: | S000001674 | DPH2 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 |
| CGD closest match: | CAL0000182165 | CAALFM_C400490WA | Diphthamide biosynthesis protein 2-2 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03900_1 | 54.90% | 623 | 0.0 | MIA_03900_1 |
| A0A0J9X9C5_GEOCN | 43.36% | 648 | 2e-152 | Similar to Saccharomyces cerevisiae YKL191W DPH2 Protein required, along with Dph1p, Kti11p, Jjj3p, and Dph5p, for synthesis of diphthamide OS=Geotrichum candidum GN=BN980_GECA06s00626g PE=3 SV=1 |
| UniRef50_A0A0J9X9C5 | 43.36% | 648 | 3e-149 | Similar to Saccharomyces cerevisiae YKL191W DPH2 Protein required, along with Dph1p, Kti11p, Jjj3p, and Dph5p, for synthesis of diphthamide n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X9C5_GEOCN |
| A0A167CSB5_9ASCO | 38.21% | 649 | 2e-124 | Dph2p OS=Sugiyamaella lignohabitans GN=DPH2 PE=3 SV=1 |
| A0A060TBB6_BLAAD | 36.93% | 612 | 1e-112 | ARAD1D26620p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D26620g PE=3 SV=1 |
| A0A1E3PRA7_9ASCO | 42.46% | 537 | 4e-111 | Diphthamide biosynthesis protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81076 PE=3 SV=1 |
| DPH2_YEAST | 35.69% | 538 | 1e-87 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH2 PE=1 SV=1 |
| DPH22_CANAL | 35.02% | 534 | 5e-76 | Diphthamide biosynthesis protein 2-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_C400490WA PE=3 SV=1 |
| DPH2_YARLI | 31.82% | 616 | 1e-74 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH2 PE=3 SV=1 |
| A0A1E4TGG6_9ASCO | 31.08% | 621 | 1e-74 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_111100 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0233
Protein family membership
- Diphthamide synthesis DPH1/DPH2 (IPR016435)
- Diphthamide synthesis DHP2, eukaryotes (IPR010014)
Domains and repeats
None predicted.
Detailed signature matches
-
-
SFLDS00032 (Radical...)
-
-
PF01866 (Diphthamid...)
-
no IPR
Unintegrated signatures
-
SFLDG01121 (Diphtha...)
-
mobidb-lite (disord...)
Residue annotation
-
SFLDG01121
Protein sequence
>MCA_03391_1 MSVSEAPVLSTNAEFDRVQQASRSAPPLSPDQFISKYSLDQVAEEIYSYFHNSTQDDNCNTSCCKTNDADKSSCGCSSSQ SKTDQTSKSVALQLPDRMIPDSAYLSTILEKQVENVYKKYNAPPTTIPRLYVLGDSSYSPCCVDTVAAQHINATVIVHFG TSCLSPVQGAHVIYVYGKENLEFGKESLAQLLTEHYKNIDDPIENLVFMYDPEYEYELQDFTAKYLSKLDNVQDIIQADL LYPNDGSTIIPKISTCEKPTPKQTDDSTDLPLDIPNRILKTEKNLTEDEFRQSGSIIYVTYGTPSSSYLLHLTTLASSVY LVDGTQAPGTINSPETSLQRRYRSMNITRTATTIGILINTLSIRNVGEAIRKVQKWITAADKKYYTFVVGKPNVPKLANF DVVDVWVILGCPLGGFIMSSNGGPDPSYYKQIITPYELKLALQPQPTWTGKWAIKFENIINNMKNLGIEEDDDEEEQEVF STNDDESEAPEFDPVTGKYVSKSRPLRAKRIAHIDIQPDKDDGGSSIDKENNNNNKGLVVRHSSQLVIRQTVSTAADHLY NKLTWTGLGSDFNQQDEEDSEDDDEQKVDENGDKIKKEKRFATVEAGRGGIARNYGIVNK
GO term prediction
Biological Process
GO:0017183 peptidyl-diphthamide biosynthetic process from peptidyl-histidine
Molecular Function
None predicted.
Cellular Component
None predicted.