Protein

MCA_03367_1

Length
153 amino acids

Browser: contigB:4196442-4196904-

RNA-seq: read pairs 1094, FPKM 87.8, percentile rank 76.8% (100% = highest expression)

Protein alignments

%idAln lengthE-value
MIA_01607_143.62%1493e-30MIA_01607_1
A0A0J9X7L5_GEOCN36.99%1463e-24Similar to Saccharomyces cerevisiae YNL149C PGA2 Essential protein required for maturation of Gas1p and Pho8p OS=Geotrichum candidum GN=BN980_GECA04s06137g PE=4 SV=1
UniRef50_A0A0J9X7L536.99%1466e-21Similar to Saccharomyces cerevisiae YNL149C PGA2 Essential protein required for maturation of Gas1p and Pho8p n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7L5_GEOCN

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6424
Predicted cleavage: 45

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR011431
    Protein trafficking Pga2
    1. PF07543 (PGA2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. Coil
  3. NON_CYTOPLASM... (N...)
  4. TMhelix
  5. TRANSMEMBRANE (Tran...)
  6. mobidb-lite (disord...)

Protein sequence

>MCA_03367_1
MWGLPENLGSSMVQNVRSYTIKDWIRIIIIVGGYALMRAQYVRWRTIKYQMKQDLEDQKLKKEAEEEAKREALEKEEAKL
RVLNEYGAGVDLPGSSGPTPAVTTTSRKGAFGWGNAAKERHANRRKYAQSIARRKAEMAQQDDSDDEISDLLH

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.