Protein
MCA_03361_1
Length
97 amino acids
Gene name: DYN2
Description: Dynein light chain 1, cytoplasmic
Browser: contigB:4181840-4182720+
RNA-seq: read pairs 1675, FPKM 211.2, percentile rank 88.7% (100% = highest expression)
Protein function
| Annotation: | DYN2 | Dynein light chain 1, cytoplasmic | |
|---|---|---|---|
| KEGG: | K10418 | DYNLL | dynein light chain LC8-type |
| EGGNOG: | 0PRDG | DYN2 | Dynein light chain |
| SGD closest match: | S000002832 | DYN2 | Dynein light chain 1, cytoplasmic |
| CGD closest match: | CAL0000184450 | orf19.1448.1 | Dynein light chain |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| Q6C9W9_YARLI | 63.04% | 92 | 2e-40 | YALI0D07700p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D07700g PE=4 SV=1 |
| A0A0J9X4N6_GEOCN | 61.11% | 90 | 2e-38 | Similar to Saccharomyces cerevisiae YDR424C DYN2 Cytoplasmic light chain dynein OS=Geotrichum candidum GN=BN980_GECA01s11186g PE=4 SV=1 |
| UniRef50_U9T5Q3 | 60.67% | 89 | 2e-34 | Uncharacterized protein n=41 Tax=Eukaryota TaxID=2759 RepID=U9T5Q3_RHIID |
| A0A1E3PI32_9ASCO | 60.92% | 87 | 1e-37 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46852 PE=4 SV=1 |
| A0A060T294_BLAAD | 53.61% | 97 | 8e-36 | ARAD1A06490p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A06490g PE=4 SV=1 |
| MIA_01620_1 | 68.49% | 73 | 4e-35 | MIA_01620_1 |
| DYL1_YEAST | 57.14% | 91 | 9e-35 | Dynein light chain 1, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DYN2 PE=1 SV=1 |
| A0A1D8PGE0_CANAL | 59.76% | 82 | 8e-34 | Dynein light chain OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1448.1 PE=4 SV=1 |
| A0A1E4TCC9_9ASCO | 45.33% | 75 | 8e-21 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28610 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0338
Protein family membership
- Dynein light chain, type 1/2 (IPR001372)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS01239 (DYNEIN_LIG...)
-
no IPR
Unintegrated signatures
-
-
SSF54648 (DLC)
Protein sequence
>MCA_03361_1 MSVNIQAPSDEFKITIKAVDMSDEMQSQIIELTQSAIQKYKLEKDIAGYIKKEADRLFGSTWHAVVGKSFGSYVTHETNH FIYFYIGPLAVLLFKTA
GO term prediction
Biological Process
GO:0007017 microtubule-based process
Molecular Function
None predicted.
Cellular Component
GO:0005875 microtubule associated complex
GO:0030286 dynein complex