Protein
MCA_03351_1
Length
256 amino acids
Gene name: SPT15
Description: TATA-box-binding protein
Browser: contigB:4128898-4129857-
RNA-seq: read pairs 3500, FPKM 168.3, percentile rank 86.1% (100% = highest expression)
Protein function
Annotation: | SPT15 | TATA-box-binding protein | |
---|---|---|---|
KEGG: | K03120 | TBP | transcription initiation factor TFIID TATA-box-binding protein |
EGGNOG: | 0PFIH | SPT15 | TATA-box-binding protein |
SGD closest match: | S000000950 | SPT15 | TATA-box-binding protein |
CGD closest match: | CAL0000189736 | TBP1 | TATA-box-binding protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XJT5_GEOCN | 96.88% | 192 | 3e-135 | Similar to Saccharomyces cerevisiae YER148W SPT15 TATA-binding protein, general transcription factor that interacts with other factors to form the preinitiation complex at promoters OS=Geotrichum candidum GN=BN980_GECA25s01055g PE=3 SV=1 |
A0A060T6M3_BLAAD | 77.78% | 261 | 1e-131 | ARAD1B16720p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B16720g PE=3 SV=1 |
A0A1E3PR56_9ASCO | 76.36% | 258 | 7e-132 | TATA-box binding protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_80904 PE=3 SV=1 |
UniRef50_A3GFP3 | 73.16% | 272 | 4e-128 | TATA-binding protein n=79 Tax=Eukaryota TaxID=2759 RepID=A3GFP3_PICST |
Q6CDL3_YARLI | 94.15% | 188 | 1e-129 | YALI0B23056p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B23056g PE=3 SV=1 |
A0A1E4THI8_9ASCO | 71.10% | 263 | 9e-127 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31928 PE=3 SV=1 |
MIA_01626_1 | 81.25% | 240 | 1e-125 | MIA_01626_1 |
TBP_YEAST | 89.29% | 196 | 4e-125 | TATA-box-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT15 PE=1 SV=3 |
TBP_CANAL | 87.76% | 196 | 3e-119 | TATA-box-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TBP1 PE=2 SV=1 |
A0A167FJL4_9ASCO | 97.81% | 137 | 1e-94 | TATA-binding protein OS=Sugiyamaella lignohabitans GN=SPT15 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0261
Protein family membership
- TATA-box binding protein (IPR000814)
- TATA-box binding protein, eukaryotic (IPR033710)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
SSF55945 (TATA-box ...)
-
mobidb-lite (disord...)
Residue annotation
-
DNA interaction su...
-
TFIIA interaction ...
-
NC2 interaction su...
-
TFIIB interaction ...
Protein sequence
>MCA_03351_1 MESLVLPNTAAQAKAFMTSLPETQQPTAAATTTTNSLNNNNNNINTNNGSSSHNNNNNVKTEDTKDEVKEANDESASGIV PTLQNIVATVNLDCRLDLKTIALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQ KLGFNTKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIY AAFEAIYPVLSEYRKA
GO term prediction
Biological Process
GO:0006352 DNA-templated transcription, initiation
Molecular Function
GO:0003677 DNA binding
Cellular Component
None predicted.