Protein

MCA_03340_1

Length
546 amino acids

Gene name: DOT1

Description: Histone-lysine N-methyltransferase, H3 lysine-79 specific

Browser: contigB:4103348-4105127-

RNA-seq: read pairs 1579, FPKM 35.7, percentile rank 57.5% (100% = highest expression)

Protein function

Annotation:DOT1Histone-lysine N-methyltransferase, H3 lysine-79 specific
KEGG:K11427DOT1L histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
EGGNOG:0PN9XDOT1Histone methyltransferase that specifically methylates histone H3 to form H3K79me. This methylation is required for telomere silencing and for the pachytene checkpoint during the meiotic cell cycle by allowing the recruitment of RAD9 to double strand breaks. Nucleosomes are preferred as substrate compared to free histones (By similarity)
SGD closest match:S000002848DOT1Histone-lysine N-methyltransferase, H3 lysine-79 specific
CGD closest match:CAL0000184097DOT1Histone-lysine N-methyltransferase, H3 lysine-79 specific

Protein alignments

%idAln lengthE-value
MIA_01595_159.88%4860.0MIA_01595_1
A0A0J9X787_GEOCN61.43%4460.0Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Geotrichum candidum GN=BN980_GECA04s07413g PE=3 SV=1
UniRef50_A0A0J9X78761.43%4460.0Histone-lysine N-methyltransferase, H3 lysine-79 specific n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X787_GEOCN
DOT1_YARLI56.32%3482e-140Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DOT1 PE=3 SV=1
A0A060SWL5_BLAAD52.10%4055e-135Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A06028g PE=3 SV=1
A0A1E3PI39_9ASCO56.62%3259e-135DOT1-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_26704 PE=4 SV=1
A0A167CPB5_9ASCO57.82%3394e-130Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Sugiyamaella lignohabitans GN=DOT1 PE=3 SV=1
DOT1_YEAST37.04%3244e-65Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOT1 PE=1 SV=1
DOT1_CANAL41.48%2292e-44Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DOT1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9260
Predicted cleavage: 89

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 500 546

Detailed signature matches

  1. Family IPR021162
    Histone H3-K79 methyltransferase, fungi
    1. PIRSF017570 (H3K79_...)
  2. Domain IPR029063
    S-adenosyl-L-methionine-dependent methyltransferase
    1. SSF53335 (S-adenosy...)
  3. Domain IPR025789
    Histone-lysine N-methyltransferase DOT1 domain
    1. PF08123 (DOT1)
    2. PS51569 (DOT1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. cd02440 (AdoMet_MTases)
  3. mobidb-lite (disord...)

Residue annotation

  1. S-adenosylmethioni...

Protein sequence

>MCA_03340_1
MFFSKLNQSNPAKPMANVKVKTVKVKKTPPSNPLSKPSSTTGANKSSSIKKRPRSETSSSSTSSATKRQTTENNSSSNSN
KSYKISRESSVEKSVRQAPRRKSRAPDLSMFNRASSDEEIDDSNWEAEFNRFSSSATPSSPSVATPLGKISTDTPPLSDD
NFASTPINKIEDTRVVYSGKWKHVNVINAVSLKKFAEYIPVFKDNTNLEYELAMPSTIFREKYFACTPKSPEEFNPILET
EQVMELVALYFVPPEYTNTIKHPSLEDCIVRRYRRAIKAGDSKKFLEAITEYNQLIDRLRKNGTIANHLKEMTKLPTAIS
RFLLNQVYARVVSPVANQLRDYKAFSNNVYGELLPDFISTIFKQTGLTSKMVFIDLGSGVGNCTLQAALEIGCESWGCEV
MKTASSLATKQQAEMEERVKMYGLKIGSINLISEDFVESDLVHKKVSEADVLLINNYAFDGKLNSHLLDMFLDLKEGARI
VSLKSFVPPGHVISEHNIQSPANLLSVEKMEFPSGSVSWTIAPGPYFISTVDRSRLEKFFKSRGMN

GO term prediction

Biological Process

GO:0000077 DNA damage checkpoint
GO:0006281 DNA repair
GO:0006348 chromatin silencing at telomere
GO:0034729 histone H3-K79 methylation

Molecular Function

GO:0018024 histone-lysine N-methyltransferase activity
GO:0031493 nucleosomal histone binding

Cellular Component

GO:0005634 nucleus