Protein

MCA_03334_1

Length
440 amino acids

Gene name: HEM3

Description: Porphobilinogen deaminase

Browser: contigB:4090287-4091610-

RNA-seq: read pairs 5757, FPKM 161.3, percentile rank 85.7% (100% = highest expression)

Protein function

Annotation:HEM3Porphobilinogen deaminase
KEGG:K01749hemC hydroxymethylbilane synthase [EC:2.5.1.61]
EGGNOG:0PHQPHEM3porphobilinogen deaminase
SGD closest match:S000002364HEM3Porphobilinogen deaminase
CGD closest match:CAL0000176208HEM3Porphobilinogen deaminase

Protein alignments

%idAln lengthE-value
MIA_05644_176.30%3460.0MIA_05644_1
A0A0J9XA67_GEOCN67.24%3484e-175Similar to Saccharomyces cerevisiae YDL205C HEM3 Porphobilinogen deaminase, catalyzes the conversion of 4-porphobilinogen to hydroxymethylbilane, the third step in heme biosynthesis OS=Geotrichum candidum GN=BN980_GECA05s05598g PE=4 SV=1
A0A167D4U7_9ASCO61.37%3213e-140Hydroxymethylbilane synthase OS=Sugiyamaella lignohabitans GN=HEM3 PE=4 SV=1
A0A060TDV1_BLAAD58.26%3452e-133ARAD1D46948p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46948g PE=4 SV=1
HEM3_YARLI58.91%3313e-133Porphobilinogen deaminase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM3 PE=3 SV=1
HEM3_CANAL58.82%3235e-129Porphobilinogen deaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HEM3 PE=3 SV=1
UniRef50_O9404858.82%3231e-125Porphobilinogen deaminase n=22 Tax=saccharomyceta TaxID=716545 RepID=HEM3_CANAL
A0A1E3PQK8_9ASCO58.43%3322e-124Porphobilinogen deaminase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40739 PE=4 SV=1
HEM3_YEAST54.01%3241e-110Porphobilinogen deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM3 PE=1 SV=1
A0A1E4TIZ7_9ASCO54.71%2762e-99Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30011 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0208

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 440

Detailed signature matches

  1. Family IPR000860
    Porphobilinogen deaminase
    1. PR00151 (PORPHBDMNASE)
    2. TIGR00212
  2. Domain IPR022417
    Porphobilinogen deaminase, N-terminal
    1. PF01379 (Porphobil_...)
  3. Domain IPR022418
    Porphobilinogen deaminase, C-terminal
    1. PF03900 (Porphobil_...)
    2. G3DSA:3.30.16...
    3. SSF54782 (Porphobil...)
  4. SITE IPR022419
    Porphobilinogen deaminase, dipyrromethane cofactor binding site
    1. PS00533 (PORPHOBILI...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.19...
  2. SSF53850 (Periplasm...)
  3. cd13645 (PBP2_HuPBG...)
  4. mobidb-lite (disord...)

Residue annotation

  1. ligand binding sit...
  2. dimer interface cd...

Protein sequence

>MCA_03334_1
MSLTQVSPPMVLTQDVPFGAPMFIPSEKRKQSVSAPSVPATMDRFMPLVKHQQQQESQPEPHSDPQVQQATTAAPVAPTS
APAQPQTSETKKDDECPEKDSNIVFHNEYIRPNTSEENTITIGGRKSILATVQSKSVARDLYSACPTQSFPVIALSTLGD
LVQGKPLYSFGGKSLWTKELEALMLQEIPGLPKVDLIVHSLKDMPTTLPEGCCLGAITEREDPRDAVIMKANTKYVNISD
LPAGAVVGTSSIRRSAQLRKNFPHLKFESVRGNVQTRLRKLDDPNSQYSCIILAVAGLSRLGLSDRITSILDVPDMYYAV
GQGALGIEIKSNDEKVKSLLAKINHPETYLKCVAERTLMRTLEGGCSVPIGVHTTFIEEDVMKFSGIVVSVDGTTFVEAT
VTGSVTTMEQAQELGSKLAKELIEKGAKAILDSIHLDHIN

GO term prediction

Biological Process

GO:0018160 peptidyl-pyrromethane cofactor linkage
GO:0033014 tetrapyrrole biosynthetic process

Molecular Function

GO:0004418 hydroxymethylbilane synthase activity

Cellular Component

None predicted.