Protein

MCA_03308_1

Length
261 amino acids

Gene name: RPS2

Description: 40S ribosomal protein S2

Browser: contigB:3983491-3984277-

RNA-seq: read pairs 45038, FPKM 2124.0, percentile rank 97.9% (100% = highest expression)

Protein function

Annotation:RPS240S ribosomal protein S2
KEGG:K02981RP-S2e small subunit ribosomal protein S2e
EGGNOG:0PG67RPS240s ribosomal protein S2
SGD closest match:S000003091RPS240S ribosomal protein S2
CGD closest match:CAL0000191073RPS21Ribosomal 40S subunit protein S2

Protein alignments

%idAln lengthE-value
MIA_06166_187.39%2221e-142MIA_06166_1
A0A060T2L7_BLAAD76.79%2242e-132ARAD1A09460p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A09460g PE=3 SV=1
RS2_YEAST79.64%2217e-13040S ribosomal protein S2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS2 PE=1 SV=3
UniRef50_P2544379.64%2212e-12640S ribosomal protein S2 n=92 Tax=Eukaryota TaxID=2759 RepID=RS2_YEAST
A0A1E3PCR4_9ASCO77.58%2237e-128Ribosomal protein S5 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48304 PE=3 SV=1
A0A0J9X9M3_GEOCN81.53%2229e-127Similar to Saccharomyces cerevisiae YGL123W RPS2 Protein component of the small (40S) subunit, essential for control of translational accuracy OS=Geotrichum candidum GN=BN980_GECA06s01407g PE=3 SV=1
A0A167DR20_9ASCO81.45%2214e-126Ribosomal 40S subunit protein S2 OS=Sugiyamaella lignohabitans GN=RPS2 PE=3 SV=1
A0A1E4TF80_9ASCO72.52%2223e-119Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_106557 PE=3 SV=1
Q6C5W9_YARLI75.78%2234e-116YALI0E14465p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E14465g PE=3 SV=1
Q5A900_CANAL74.66%2213e-109Ribosomal 40S subunit protein S2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS21 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0064

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 261

Detailed signature matches

  1. Family IPR005711
    Ribosomal protein S5, eukaryotic/archaeal
    1. TIGR01020
  2. Domain IPR013810
    Ribosomal protein S5, N-terminal
    1. PF00333 (Ribosomal_S5)
    2. PS50881 (S5_DSRBD)
  3. Domain IPR020568
    Ribosomal protein S5 domain 2-type fold
    1. SSF54211 (Ribosomal...)
  4. Domain IPR014721
    Ribosomal protein S5 domain 2-type fold, subgroup
    1. G3DSA:3.30.23...
  5. Domain IPR005324
    Ribosomal protein S5, C-terminal
    1. PF03719 (Ribosomal_...)
  6. SITE IPR018192
    Ribosomal protein S5, N-terminal, conserved site
    1. PS00585 (RIBOSOMAL_S5)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.16...
  2. SSF54768 (dsRNA-bin...)
  3. mobidb-lite (disord...)

Protein sequence

>MCA_03308_1
MSEAAAPQQQQQPEGGRGGFGGRPQRRGGPRGRRGNKREEEKGWQPVTKLGRLVKAGKITSLEEIYYHALPVKEYQIIDT
FLPKLEDKVMNIKPVQKQTRAGQRTRFKAVVLVGDSNGHIGLGIKSAKEVATAIRSAIIIAKLSMIPIRRGYWGSALGEP
HSLATKVEGKCGSVTVKLIPAPRGTGVVASPAVKTLLQLGGVQDAYTASFGSTRTLENTLKAAFIAVGNTYGFLTPNLWA
PTTIQPSPLDVYSDIASSKKA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome
GO:0015935 small ribosomal subunit