Protein

MCA_03298_1

Length
248 amino acids


Gene name: GPM1

Description: Phosphoglycerate mutase 1

Browser: contigB:3960553-3961300+

RNA-seq: read pairs 56658, FPKM 2811.5, percentile rank 98.3% (100% = highest expression)

Protein function

Annotation:GPM1Phosphoglycerate mutase 1
KEGG:K01834PGAM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
EGGNOG:0PI8IGPM1Phosphoglycerate mutase
SGD closest match:S000001635GPM1Phosphoglycerate mutase 1
CGD closest match:CAL0000185566GPM1Phosphoglycerate mutase

Protein alignments

%idAln lengthE-value
A0A0J9X4D5_GEOCN87.90%2484e-153Phosphoglycerate mutase OS=Geotrichum candidum GN=BN980_GECA02s04190g PE=3 SV=1
MIA_05116_186.29%2485e-151MIA_05116_1
A0A167BZH5_9ASCO85.43%2477e-146Phosphoglycerate mutase OS=Sugiyamaella lignohabitans GN=GPM1 PE=3 SV=1
A0A1E4TKQ6_9ASCO76.61%2484e-132Phosphoglycerate mutase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30505 PE=3 SV=1
A0A060T9G6_BLAAD76.73%2453e-131Phosphoglycerate mutase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D15092g PE=3 SV=1
Q6CFX7_YARLI78.78%2453e-130Phosphoglycerate mutase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B02728g PE=3 SV=1
A0A1E3PJU9_9ASCO77.25%2332e-129Phosphoglycerate mutase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52064 PE=3 SV=1
PMGY_CANAL75.51%2452e-125Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPM1 PE=1 SV=3
UniRef50_P8261275.51%2454e-122Phosphoglycerate mutase n=2697 Tax=root TaxID=1 RepID=PMGY_CANAL
PMG1_YEAST74.29%2459e-125Phosphoglycerate mutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPM1 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1679

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. SSF53254 (Phosphogl...)
    1. PF00300 (His_Phos_1)
    2. SM00855 (PGAM_5)
    3. cd07067 (HP_PGM_like)
    1. MF_01039 (PGAM_GpmA)
    1. PS00175 (PG_MUTASE)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PIRSF000709 (6PFK_f...)

Residue annotation

  1. catalytic core cd0...

Protein sequence

>MCA_03298_1
MVHKLILVRHGQSDWNEKNLFTGWVDVRLSELGKKEAARAGELLVESKIVPDIVYTSKLSRAIQTCNIALDNADLLYLDV
KRNWRLNERHYGALQGKDKAQTLAEFGNEQFMTWRRSFDVPPPPIADDSEYSQFNDPRYKDIPKEDIPKTESLALVIDRL
LPYWKSDISKDLLDGKTVIVFAHGNSLRALVKHLDGISDADIAGLNIPTGIPLVYELDDNLKPTKPAYYLDPEAAEAGAK
AVANQGKK

GO term prediction

Biological Process

GO:0006096 glycolytic process
GO:0008152 metabolic process

Molecular Function

GO:0003824 catalytic activity
GO:0004619 phosphoglycerate mutase activity
GO:0016868 intramolecular transferase activity, phosphotransferases

Cellular Component

None predicted.