Protein

MCA_03295_1

Length
102 amino acids

Gene name: URM1

Description: Ubiquitin-related modifier 1

Browser: contigB:3955422-3956031-

RNA-seq: read pairs 772, FPKM 92.6, percentile rank 77.4% (100% = highest expression)

Protein function

Annotation:URM1Ubiquitin-related modifier 1
KEGG:K12161URM1 ubiquitin related modifier 1
EGGNOG:0PR1EURM1Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions. Serves as sulfur donor in tRNA 2-thiolation reaction by being thiocarboxylated (-COSH) at its C-terminus by uba4. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also act as an ubiquitin-like protein that is covalently conjugated to other proteins such as ahp1
SGD closest match:S000001270URM1Ubiquitin-related modifier 1
CGD closest match:CAL0000198786URM1Ubiquitin-related modifier 1

Protein alignments

%idAln lengthE-value
A0A0J9X6Y7_GEOCN57.84%1023e-34Ubiquitin-related modifier 1 OS=Geotrichum candidum GN=URM1 PE=3 SV=1
UniRef50_Q1E49352.94%1029e-29Ubiquitin-related modifier 1 n=91 Tax=Opisthokonta TaxID=33154 RepID=URM1_COCIM
URM1_YARLI47.62%1058e-29Ubiquitin-related modifier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=URM1 PE=3 SV=1
A0A060TAC5_BLAAD56.86%1022e-28Ubiquitin-related modifier 1 OS=Blastobotrys adeninivorans GN=URM1 PE=3 SV=1
A0A1E4TFI7_9ASCO46.08%1021e-25Ubiquitin-related modifier 1 OS=Tortispora caseinolytica NRRL Y-17796 GN=URM1 PE=3 SV=1
A0A1E3PK98_9ASCO50.47%1071e-23Ubiquitin-related modifier 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=URM1 PE=3 SV=1
URM1_YEAST40.20%1029e-24Ubiquitin-related modifier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URM1 PE=1 SV=1
URM1_CANAL42.16%1023e-22Ubiquitin-related modifier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URM1 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1113

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 90 102

Detailed signature matches

  1. Family IPR015221
    Ubiquitin-related modifier 1
    1. MF_03048 (Urm1)
    2. PF09138 (Urm1)
    3. PIRSF037379 (Urm1)
  2. Domain IPR012675
    Beta-grasp domain
    1. G3DSA:3.10.20.30
  3. Domain IPR016155
    Molybdopterin synthase/thiamin biosynthesis sulphur carrier, beta-grasp
    1. SSF54285 (MoaD/ThiS)

Protein sequence

>MCA_03295_1
MKVSISFTGGLETLFHNKRQLTLDIDPSTGNDAPYTIQRLINHLIETEMDSTKDKEMFLQNGHVRPGILVLINDADWELE
GEEEYQVQPNDNILFASTLHGG

GO term prediction

Biological Process

GO:0034227 tRNA thio-modification

Molecular Function

None predicted.

Cellular Component

GO:0005737 cytoplasm