Protein
MCA_03266_1
Length
268 amino acids
Gene name: VPS28
Description: Vacuolar protein sorting-associated protein 28
Browser: contigB:3865964-3866771+
RNA-seq: read pairs 903, FPKM 41.5, percentile rank 61.1% (100% = highest expression)
Protein function
| Annotation: | VPS28 | Vacuolar protein sorting-associated protein 28 | |
|---|---|---|---|
| KEGG: | K12184 | VPS28 | ESCRT-I complex subunit VPS28 |
| EGGNOG: | 0PJD3 | VPS28 | Vacuolar protein sorting-associated protein |
| SGD closest match: | S000005986 | VPS28 | Vacuolar protein sorting-associated protein 28 |
| CGD closest match: | CAL0000187534 | VPS28 | Vacuolar protein sorting-associated protein 28 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05656_1 | 57.72% | 272 | 5e-96 | MIA_05656_1 |
| A0A060T0Y0_BLAAD | 56.49% | 262 | 1e-88 | Vacuolar protein sorting-associated protein 28 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11990g PE=3 SV=1 |
| A0A167F3J4_9ASCO | 52.73% | 275 | 1e-86 | Vacuolar protein sorting-associated protein 28 OS=Sugiyamaella lignohabitans GN=VPS28 PE=3 SV=1 |
| UniRef50_A0A167F3J4 | 52.73% | 275 | 4e-83 | Vacuolar protein sorting-associated protein 28 n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A167F3J4_9ASCO |
| A0A0J9XH56_GEOCN | 54.14% | 266 | 5e-86 | Vacuolar protein sorting-associated protein 28 OS=Geotrichum candidum GN=BN980_GECA16s00791g PE=3 SV=1 |
| F2Z6B2_YARLI | 46.51% | 258 | 6e-71 | Vacuolar protein sorting-associated protein 28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A18722g PE=3 SV=1 |
| A0A1E4TL07_9ASCO | 48.97% | 243 | 9e-67 | Vacuolar protein sorting-associated protein 28 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147585 PE=3 SV=1 |
| A0A1E3PNK4_9ASCO | 45.39% | 271 | 8e-65 | Vacuolar protein sorting-associated protein 28 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50718 PE=3 SV=1 |
| VPS28_YEAST | 37.34% | 241 | 5e-45 | Vacuolar protein sorting-associated protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS28 PE=1 SV=1 |
| Q59SD1_CANAL | 35.07% | 288 | 4e-38 | Vacuolar protein sorting-associated protein 28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS28 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0442
Protein family membership
- Vacuolar protein sorting-associated, VPS28 (IPR007143)
Domains and repeats
-
Domain
1
50
100
150
200
268
Detailed signature matches
-
-
PF03997 (VPS28)
-
PIRSF017535 (ESCRT1...)
-
-
-
PS51313 (VPS28_N)
-
-
-
PS51310 (VPS28_C)
-
no IPR
Unintegrated signatures
-
SSF140111 (Endosoma...)
-
SSF140427 (VPS28 C-...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_03266_1 MSQVPAYAPTSSYSSITPAASIPLDEEVKLHTSIKEREIYESLAEIHAIILSLDFLEKAVLRDSVSHEEYTPTCLRLIAQ YNGILKNELVAEQFKSLEDFKEKYGLEYELGIGRLKVGVPVTVENAMNNSDLLEKDSDTTDNNNKNNNNNNNSNNNNNNN NNNTVKSAKAIAEITGNFITCMDAVKLNYKAKDQLHPLLSELMTSLNRMDSSIFDSSSGGGFQGRGKLVQWLITLNELKI NEEISDDQARQLLFDLDNAYKEFYTSLE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.