Protein

MCA_03266_1

Length
268 amino acids

Gene name: VPS28

Description: Vacuolar protein sorting-associated protein 28

Browser: contigB:3865964-3866771+

RNA-seq: read pairs 903, FPKM 41.5, percentile rank 61.1% (100% = highest expression)

Protein function

Annotation:VPS28Vacuolar protein sorting-associated protein 28
KEGG:K12184VPS28 ESCRT-I complex subunit VPS28
EGGNOG:0PJD3VPS28Vacuolar protein sorting-associated protein
SGD closest match:S000005986VPS28Vacuolar protein sorting-associated protein 28
CGD closest match:CAL0000187534VPS28Vacuolar protein sorting-associated protein 28

Protein alignments

%idAln lengthE-value
MIA_05656_157.72%2725e-96MIA_05656_1
A0A060T0Y0_BLAAD56.49%2621e-88Vacuolar protein sorting-associated protein 28 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11990g PE=3 SV=1
A0A167F3J4_9ASCO52.73%2751e-86Vacuolar protein sorting-associated protein 28 OS=Sugiyamaella lignohabitans GN=VPS28 PE=3 SV=1
UniRef50_A0A167F3J452.73%2754e-83Vacuolar protein sorting-associated protein 28 n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A167F3J4_9ASCO
A0A0J9XH56_GEOCN54.14%2665e-86Vacuolar protein sorting-associated protein 28 OS=Geotrichum candidum GN=BN980_GECA16s00791g PE=3 SV=1
F2Z6B2_YARLI46.51%2586e-71Vacuolar protein sorting-associated protein 28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A18722g PE=3 SV=1
A0A1E4TL07_9ASCO48.97%2439e-67Vacuolar protein sorting-associated protein 28 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147585 PE=3 SV=1
A0A1E3PNK4_9ASCO45.39%2718e-65Vacuolar protein sorting-associated protein 28 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50718 PE=3 SV=1
VPS28_YEAST37.34%2415e-45Vacuolar protein sorting-associated protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS28 PE=1 SV=1
Q59SD1_CANAL35.07%2884e-38Vacuolar protein sorting-associated protein 28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS28 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0442

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 268

Detailed signature matches

  1. Family IPR007143
    Vacuolar protein sorting-associated, VPS28
    1. PF03997 (VPS28)
    2. PIRSF017535 (ESCRT1...)
  2. Domain IPR017898
    Vacuolar protein sorting-associated, VPS28, N-terminal
    1. PS51313 (VPS28_N)
  3. Domain IPR017899
    Vacuolar protein sorting-associated, VPS28, C-terminal
    1. PS51310 (VPS28_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF140111 (Endosoma...)
  2. SSF140427 (VPS28 C-...)
  3. mobidb-lite (disord...)

Protein sequence

>MCA_03266_1
MSQVPAYAPTSSYSSITPAASIPLDEEVKLHTSIKEREIYESLAEIHAIILSLDFLEKAVLRDSVSHEEYTPTCLRLIAQ
YNGILKNELVAEQFKSLEDFKEKYGLEYELGIGRLKVGVPVTVENAMNNSDLLEKDSDTTDNNNKNNNNNNNSNNNNNNN
NNNTVKSAKAIAEITGNFITCMDAVKLNYKAKDQLHPLLSELMTSLNRMDSSIFDSSSGGGFQGRGKLVQWLITLNELKI
NEEISDDQARQLLFDLDNAYKEFYTSLE

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.