Protein

MCA_03210_1

Length
171 amino acids


Gene name: MXR2

Description: Peptide methionine sulfoxide reductase 2

Browser: contigB:3677757-3678273-

RNA-seq: read pairs 2758, FPKM 198.1, percentile rank 87.9% (100% = highest expression)

Protein function

Annotation:MXR2Peptide methionine sulfoxide reductase 2
KEGG:K07305msrB peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
EGGNOG:0PPVGFG09500.1)-reductase
SGD closest match:S000000538MXR2Peptide methionine sulfoxide reductase 2
CGD closest match:CAL0000183037orf19.3292Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_00852_168.53%1431e-73MIA_00852_1
A0A0J9X9V3_GEOCN62.80%1649e-73Similar to Saccharomyces cerevisiae YCL033C MXR2 Methionine-R-sulfoxide reductase, involved in the response to oxidative stress OS=Geotrichum candidum GN=BN980_GECA06s02364g PE=4 SV=1
UniRef50_A0A1C7NAA970.63%1263e-64Peptide methionine sulfoxide reductase B5 n=2 Tax=Eukaryota TaxID=2759 RepID=A0A1C7NAA9_9FUNG
Q6CCY5_YARLI69.84%1261e-66YALI0C05533p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05533g PE=4 SV=1
Q5A942_CANAL65.41%1332e-62Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3292 PE=4 SV=1
A0A1E4THD8_9ASCO62.79%1292e-61Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2816 PE=4 SV=1
A0A060TD19_BLAAD58.22%1469e-59ARAD1B20614p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B20614g PE=4 SV=1
A0A1E3PNN2_9ASCO57.89%1332e-51Methionine sulfoxide reductase B OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_21952 PE=4 SV=1
MXR2_YEAST51.39%1444e-45Peptide methionine sulfoxide reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MXR2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9945

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 171

Detailed signature matches

    1. SSF51316 (Mss4-like)
    1. PS51790 (MSRB)
    2. PF01641 (SelR)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_03210_1
MFVRSLRRRSIIKVPQFATTTTRSQLFFFSSFNKMSQEYKVNKSESEWQAILSPEQFRVLRLKGTEPPGTGEYDKVFEPG
VYTCAACDAPLYKAETKFDSGCGWPAFYEAIPGSIKLFDDASLGRLRTEMVCANCGGHLGHVFKGEGFKTPTDERHCVNS
ISIKLKPADKA

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0033743 peptide-methionine (R)-S-oxide reductase activity

Cellular Component

None predicted.