Protein
MCA_03204_1
Length
234 amino acids
Gene name: CDC31
Description: Cell division control protein 31; protein with calcium-binding domain
Browser: contigB:3640827-3641625-
RNA-seq: read pairs 814, FPKM 42.8, percentile rank 61.9% (100% = highest expression)
Protein function
| Annotation: | CDC31 | Cell division control protein 31; protein with calcium-binding domain | |
|---|---|---|---|
| KEGG: | K16466 | CETN3 | centrin-3 |
| EGGNOG: | 0PR43 | CDC31 | Cell division control protein |
| SGD closest match: | S000005783 | CDC31 | Cell division control protein 31 |
| CGD closest match: | CAL0000201050 | CAALFM_CR04020CA | Centrin |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A1E4TLD4_9ASCO | 51.88% | 160 | 1e-52 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23784 PE=4 SV=1 |
| MIA_00987_1 | 54.60% | 163 | 3e-51 | MIA_00987_1 |
| A0A0J9XJ71_GEOCN | 52.50% | 160 | 1e-49 | Similar to Saccharomyces cerevisiae YOR257W CDC31 Calcium-binding component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II OS=Geotrichum candidum GN=BN980_GECA20s00813g PE=4 SV=1 |
| A0A060T5Q8_BLAAD | 52.50% | 160 | 1e-49 | ARAD1C06886p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C06886g PE=4 SV=1 |
| UniRef50_A0A0F4X8P4 | 50.31% | 159 | 3e-45 | Cell division control protein 31 n=29 Tax=Saccharomycetales TaxID=4892 RepID=A0A0F4X8P4_HANUV |
| A0A1E3PIA1_9ASCO | 46.54% | 159 | 8e-43 | EF-hand protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83229 PE=4 SV=1 |
| Q6CGC2_YARLI | 44.65% | 159 | 2e-41 | YALI0A20518p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A20518g PE=4 SV=1 |
| CDC31_YEAST | 47.53% | 162 | 1e-41 | Cell division control protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC31 PE=1 SV=2 |
| A0A1D8PSM8_CANAL | 45.91% | 159 | 7e-40 | Centrin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR04020CA PE=4 SV=1 |
| A0A167E997_9ASCO | 32.93% | 82 | 2e-10 | Calmodulin OS=Sugiyamaella lignohabitans GN=CMD1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4855
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
200
234
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Residue annotation
-
Ca2+ binding site ...
Protein sequence
>MCA_03204_1 MSNHLYIPNANNNNTITPMSTTNTSDKGSKGNRRLNNIRKPFFSIHQAQAQSQLQTPQGQQNSERNNQEMDTDITSEQMQ EIRETFDLFDTDHDNLMDYHEFKVAMRALGFDHTKPEVLALLKKNNVIQPDPSNPNHIPGEVSPHNQRINYENFSTLMIK KIAERDPLTDIKRSFQLFDVNGSGMIEFEDLKAVAGELSENITDEELTAMIEEFDLDMDNGINEQEFIDICLKF
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0005509 calcium ion binding
Cellular Component
None predicted.