Protein
MCA_03153_1
Length
336 amino acids
Browser: contigB:3503090-3504101+
RNA-seq: read pairs 320, FPKM 11.7, percentile rank 28.8% (100% = highest expression)
Protein function
| KEGG: | K00587 | ICMT | protein-S-isoprenylcysteine O-methyltransferase [EC:2.1.1.100] |
|---|---|---|---|
| EGGNOG: | 0PJHF | PGUG_02927 | carboxyl methyltransferase |
| SGD closest match: | S000002818 | STE14 | Protein-S-isoprenylcysteine O-methyltransferase |
| CGD closest match: | CAL0000199995 | orf19.119 | Protein-S-isoprenylcysteine O-methyltransferase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04214_1 | 55.03% | 298 | 9e-103 | MIA_04214_1 |
| A0A0J9X336_GEOCN | 46.72% | 259 | 3e-69 | Protein-S-isoprenylcysteine O-methyltransferase OS=Geotrichum candidum GN=BN980_GECA01s00747g PE=3 SV=1 |
| A0A060T6X3_BLAAD | 50.73% | 205 | 1e-68 | Protein-S-isoprenylcysteine O-methyltransferase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B23012g PE=3 SV=1 |
| UniRef50_A0A060T6X3 | 50.73% | 205 | 3e-65 | Protein-S-isoprenylcysteine O-methyltransferase n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T6X3_BLAAD |
| Q6C4X7_YARLI | 48.00% | 200 | 6e-57 | Protein-S-isoprenylcysteine O-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E22913g PE=3 SV=1 |
| STE14_YEAST | 49.00% | 200 | 2e-49 | Protein-S-isoprenylcysteine O-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE14 PE=1 SV=1 |
| A0A1E3PMB6_9ASCO | 60.00% | 120 | 1e-47 | Protein-S-isoprenylcysteine O-methyltransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82257 PE=3 SV=1 |
| A0A1E4TCG6_9ASCO | 42.79% | 201 | 6e-42 | Protein-S-isoprenylcysteine O-methyltransferase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_139796 PE=3 SV=1 |
| A0A1D8PPI7_CANAL | 32.22% | 239 | 2e-30 | Protein-S-isoprenylcysteine O-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.119 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0050
Protein family membership
- Isoprenylcysteine carboxyl methyltransferase (IPR007269)
- Protein-S-isoprenylcysteine O-methyltransferase (IPR025770)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_03153_1 MPSSSSQDHNINTPSETDNLVAGSTKYTDFSSGSSSDGSTSSFSNTQQSFLKDDAELQKVMDSILHAVPPAVACNTAEVS YTAFALGTVLGVSLIFALSLGSQAVLPLVGVSYTSITSAVHALLNPTNIPWQLPTYFCCLCVFHFMEYWTTATYNPQKVL PSSFLLRNGQLYLIAHSLALTETLVLRYFNFWPFTKIPNSIRLVFSPDNESKAGLYISLVGLLVVIAGQTLRSCAMIHAA SNFSHTIVKARDSAHQLVTTGVYSLSRHPSYSGFYFWALGSQILLVNPVSFVVFLCLLWNFFSNRIKDEEQYLILFFGKD YIEYKKKTPTLIPFIK
GO term prediction
Biological Process
GO:0006481 C-terminal protein methylation
Molecular Function
GO:0004671 protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0016021 integral component of membrane