Protein

MCA_03129_1

Length
578 amino acids

Gene name: URA7

Description: CTP synthase 1

Browser: contigB:3446154-3447987+

RNA-seq: read pairs 6316, FPKM 134.8, percentile rank 83.5% (100% = highest expression)

Protein function

Annotation:URA7CTP synthase 1
KEGG:K01937pyrG CTP synthase [EC:6.3.4.2]
EGGNOG:0PI55URA7CTP synthase
SGD closest match:S000000135URA7CTP synthase 1
CGD closest match:CAL0000193754URA7CTP synthase

Protein alignments

%idAln lengthE-value
MIA_03094_180.87%5490.0MIA_03094_1
A0A0J9XJ55_GEOCN79.14%5370.0CTP synthase OS=Geotrichum candidum GN=BN980_GECA24s00175g PE=3 SV=1
A0A167C034_9ASCO76.85%5270.0CTP synthase OS=Sugiyamaella lignohabitans GN=URA7 PE=3 SV=1
A0A1E3PF44_9ASCO70.39%5370.0CTP synthase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84069 PE=3 SV=1
Q5AK79_CANAL70.58%5370.0CTP synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URA7 PE=3 SV=1
Q6CFN6_YARLI67.95%5460.0CTP synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B05368g PE=3 SV=1
A0A060T9W7_BLAAD69.49%5310.0CTP synthase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17974g PE=3 SV=1
URA7_YEAST68.23%5320.0CTP synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA7 PE=1 SV=2
A0A1E4TKV2_9ASCO67.35%5360.0CTP synthase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30540 PE=3 SV=1
UniRef50_P3862767.03%5490.0CTP synthase 2 n=528 Tax=cellular organisms TaxID=131567 RepID=URA8_YEAST

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5251

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 578

Detailed signature matches

  1. Family IPR004468
    CTP synthase
    1. TIGR00337
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR017456
    CTP synthase, N-terminal
    1. PF06418 (CTP_synth_N)
  4. Domain IPR029062
    Class I glutamine amidotransferase-like
    1. G3DSA:3.40.50...
    2. SSF52317 (Class I g...)
  5. Domain IPR017926
    Glutamine amidotransferase
    1. PF00117 (GATase)
    2. PS51273 (GATASE_TYPE_1)
  6. Domain IPR033828
    CTP synthase GATase domain
    1. cd01746 (GATase1_CT...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. NON_CYTOPLASM... (N...)
  3. SIGNAL_PEPTIDE (Sig...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SIGNAL_PEPTID... (S...)

Residue annotation

  1. active site cd01746
  2. putative oxyanion ...
  3. catalytic triad cd...

Protein sequence

>MCA_03129_1
MKFVVVSGGVISGIGKGVIASSTGLLLKTLGLHVTSIKIDPYMNIDAGTMSPLEHGEVFVLDDGGEADLDLGNYERYLNV
TLTRKHNITTGKVYQQVIERERRGDYLGKTVQVVPHLTNAIQEWIETVAKIPVDGNDDVPDVCIVELGGTVGDIESAPFV
EALRQFQFRAGPENFALIHVSLVPVINGERKTKPTQAAIKDLRSLGLTPDMIACRCSEKLDQAAIEKISMFCHVGPEQVL
AVHDVNSTYHVPLLLKEQKMIKFFQKRLKLDEIFLAKERIDKGKDLWSRWLKLTNSHDRSYESVSIAIVGKYTNLQDSYI
SVVKALEHAALAVQKRIKIVWVDSSDLEIEASTEDKIKYHQAWSNVCSADGILVPGGFGSRGTEGMVSAAKWARENNVPY
LGICLGFQVAVIEFARNVMRMETNSIELDPQVTDPIIVFMPEIDKTHLGGTMRLGNRPSYFQEGTEWSKLRKLYGLPDKV
HERHRHRYEVNPEHISEIESAGMPFIAKDETGNRMESFELKDHPFFVGTQYHPEYLSKVLIPSAPFLGLVSASSGCLDEV
IEKIKRNGSISDMNEAEF

GO term prediction

Biological Process

GO:0006221 pyrimidine nucleotide biosynthetic process
GO:0006241 CTP biosynthetic process

Molecular Function

GO:0003883 CTP synthase activity

Cellular Component

None predicted.