Protein

MCA_03102_1

Length
392 amino acids

Gene name: HIS5

Description: Histidinol-phosphate aminotransferase

Browser: contigB:3378568-3379816-

RNA-seq: read pairs 2190, FPKM 68.9, percentile rank 72.3% (100% = highest expression)

Protein function

Annotation:HIS5Histidinol-phosphate aminotransferase
KEGG:K00817hisC histidinol-phosphate aminotransferase [EC:2.6.1.9]
EGGNOG:0PGU7HIS5Histidinol-phosphate aminotransferase
SGD closest match:S000001378HIS5Histidinol-phosphate aminotransferase
CGD closest match:CAL0000198056HIS5Histidinol-phosphate transaminase

Protein alignments

%idAln lengthE-value
MIA_02815_170.10%3980.0MIA_02815_1
A0A0J9XBW4_GEOCN69.11%3950.0Similar to Saccharomyces cerevisiae YIL116W HIS5 Histidinol-phosphate aminotransferase catalyzes the seventh step in histidine biosynthesis OS=Geotrichum candidum GN=BN980_GECA08s02991g PE=3 SV=1
A0A1E3PH74_9ASCO60.66%3941e-172Histidinol-phosphate aminotransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83637 PE=3 SV=1
A0A060SYS7_BLAAD60.76%3953e-169ARAD1A14212p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A14212g PE=3 SV=1
Q6C7F4_YARLI58.72%3901e-162YALI0E01254p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E01254g PE=3 SV=1
A0A1E4TLR6_9ASCO52.84%3886e-144Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_90605 PE=3 SV=1
A0A161HLG2_9ASCO63.16%3233e-141Histidinol-phosphate transaminase OS=Sugiyamaella lignohabitans GN=HIS5 PE=3 SV=1
UniRef50_A0A161HLG263.16%3239e-138Histidinol-phosphate transaminase n=14 Tax=Fungi TaxID=4751 RepID=A0A161HLG2_9ASCO
A0A1D8PL37_CANAL52.82%3905e-138Histidinol-phosphate transaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HIS5 PE=3 SV=1
HIS8_YEAST50.13%3911e-130Histidinol-phosphate aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS5 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1813

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 392

Detailed signature matches

  1. Family IPR005861
    Histidinol-phosphate aminotransferase family
    1. MF_01023 (HisC_amin...)
    2. TIGR01141
  2. Domain IPR015422
    Pyridoxal phosphate-dependent transferase, subdomain 2
    1. G3DSA:3.90.11...
  3. Domain IPR015424
    Pyridoxal phosphate-dependent transferase
    1. SSF53383 (PLP-depen...)
  4. Domain IPR004839
    Aminotransferase, class I/classII
    1. PF00155 (Aminotran_1_2)
  5. Domain IPR015421
    Pyridoxal phosphate-dependent transferase, major region, subdomain 1
    1. G3DSA:3.40.64...
  6. SITE IPR001917
    Aminotransferase, class-II, pyridoxal-phosphate binding site
    1. PS00599 (AA_TRANSFE...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd00609 (AAT_like)

Residue annotation

  1. pyridoxal 5'-phosp...
  2. homodimer interfac...
  3. catalytic residue ...

Protein sequence

>MCA_03102_1
MASFNLQTLARPNILALEPYRCARDDYQTGILLDANENTHGPSIEDIDEDEQGLFRYPDPRHETFKQLLCDFRNSAPAPL
KAENLTPLDPENIALGVGSDESIDALIRVFCKPGSDKLLTCPPTYGMYSVSAQINDVEVVKIPMLFNKGNFQIDTDKIME
TLSNDPSIKLVYVTSPGNPTATLIEPARIEKLLNHPTWNGIVIVDEAYIDFCPSGSSFAPLVTKYPNLAVMQTLSKAFGL
AGVRLGFTFADKSVAHLLNNMRAPYNISIPTAQLGERALSKAGLAVMKSNVAKILEERSRIIKALKGMDGVGEMVSGEDA
NFILVEILDKETKQPSTPAALKLYIYLAEKKQVIVRFRGKEPGCTGCLRISIGTKEENDTLLKEFEQGLKTL

GO term prediction

Biological Process

GO:0000105 histidine biosynthetic process
GO:0008152 metabolic process
GO:0009058 biosynthetic process

Molecular Function

GO:0003824 catalytic activity
GO:0004400 histidinol-phosphate transaminase activity
GO:0016740 transferase activity
GO:0030170 pyridoxal phosphate binding

Cellular Component

None predicted.