Protein
MCA_03093_1
Length
95 amino acids
Gene name: SOM1
Description: mitochondrial inner membrane protease subunit SOM1
Browser: contigB:3355428-3355774+
RNA-seq: read pairs 251, FPKM 32.3, percentile rank 54.8% (100% = highest expression)
Protein function
| Annotation: | SOM1 | mitochondrial inner membrane protease subunit SOM1 | |
|---|---|---|---|
| KEGG: | K17802 | SOM1 | mitochondrial inner membrane protease subunit SOM1 |
| SGD closest match: | S000002954 | SOM1 | Protein SOM1, mitochondrial |
| CGD closest match: | CAL0000187048 | orf19.6359 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02724_1 | 65.43% | 81 | 2e-36 | MIA_02724_1 |
| UniRef50_A0A061B5I0 | 37.18% | 78 | 4e-12 | CYFA0S15e02256g1_1 n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A061B5I0_CYBFA |
| Q59PD4_CANAL | 38.61% | 101 | 2e-12 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6359 PE=4 SV=1 |
| SOM1_YEAST | 41.77% | 79 | 5e-10 | Protein SOM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOM1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0112
Protein family membership
- Mitochondrial export protein Som1 (IPR024645)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF11093 (Mitochondr...)
-
no IPR
Unintegrated signatures
Protein sequence
>MCA_03093_1 MAPPVPVYKKSEINKLHNFLIDPKTNQPDCPLKELTQYECSVHDREIICIPFKRLFRACRSRNDEKETLIEVTDENTNLP LRSNVKTDLSRYLTP
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0042720 mitochondrial inner membrane peptidase complex