Protein
MCA_03082_1
Length
132 amino acids
Gene name: MRPL38
Description: 54S ribosomal protein L38, mitochondrial
Browser: contigB:3325551-3325950+
RNA-seq: read pairs 1694, FPKM 157.4, percentile rank 85.4% (100% = highest expression)
Protein function
| Annotation: | MRPL38 | 54S ribosomal protein L38, mitochondrial | |
|---|---|---|---|
| EGGNOG: | 0PPNT | FG06530.1 | mitochondrial 54S ribosomal protein YmL38 YmL34 |
| SGD closest match: | S000001653 | MRPL38 | 54S ribosomal protein L38, mitochondrial |
| CGD closest match: | CAL0000195479 | orf19.5684 | Mitochondrial 54S ribosomal protein YmL38/YmL34 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03114_1 | 80.58% | 139 | 1e-74 | MIA_03114_1 |
| A0A0J9XGW6_GEOCN | 75.91% | 137 | 5e-71 | Similar to Saccharomyces cerevisiae YKL170W MRPL38 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA15s02870g PE=3 SV=1 |
| A0A1D8PMU5_CANAL | 64.89% | 131 | 5e-57 | Mitochondrial 54S ribosomal protein YmL38/YmL34 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5684 PE=3 SV=1 |
| UniRef50_G8YK00 | 64.89% | 131 | 7e-52 | Piso0_002972 protein n=13 Tax=saccharomyceta TaxID=716545 RepID=G8YK00_PICSO |
| A0A060TB73_BLAAD | 68.70% | 131 | 2e-54 | ARAD1B06028p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B06028g PE=3 SV=1 |
| Q6C1C3_YARLI | 60.61% | 132 | 4e-54 | YALI0F17512p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F17512g PE=3 SV=1 |
| A0A1E3PGV0_9ASCO | 59.09% | 132 | 4e-52 | Ribosomal protein L14 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84100 PE=3 SV=1 |
| RM38_YEAST | 55.07% | 138 | 7e-46 | 54S ribosomal protein L38, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL38 PE=1 SV=1 |
| A0A1E4T9M2_9ASCO | 31.62% | 117 | 2e-10 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_146828 PE=3 SV=1 |
| A0A167E126_9ASCO | 33.33% | 117 | 3e-10 | Ribosomal 60S subunit protein L23B OS=Sugiyamaella lignohabitans GN=RPL23B PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0910
Protein family membership
- Ribosomal protein L14P (IPR000218)
- Ribosomal protein L14P, bacterial-type (IPR005745)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_03082_1 MIYLKSLLNVIDNSGALVVECIKVLGKNPKNHARIGDKIVVVVQKARPLSNQATGAAAANKLRQGDMKHAVVVRTKQLQP RSDGSVIRFDDNACVLINNSGEPIGTRVSGVVARELRDKGFNKIVALAPRTV
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit