Protein

MCA_03065_1

Length
184 amino acids


Gene name: IMP3

Description: U3 small nucleolar ribonucleoprotein protein IMP3

Browser: contigB:3236935-3237490-

RNA-seq: read pairs 820, FPKM 54.8, percentile rank 67.3% (100% = highest expression)

Protein function

Annotation:IMP3U3 small nucleolar ribonucleoprotein protein IMP3
KEGG:K14560IMP3 U3 small nucleolar ribonucleoprotein protein IMP3
EGGNOG:0PMW5IMP3u3 small nucleolar ribonucleoprotein
SGD closest match:S000001191IMP3U3 small nucleolar ribonucleoprotein protein IMP3
CGD closest match:CAL0000189738CAALFM_CR00460CASnoRNA-binding rRNA-processing protein

Protein alignments

%idAln lengthE-value
MIA_05425_178.92%1853e-107MIA_05425_1
A0A0J9XAV5_GEOCN66.30%1843e-89Similar to Saccharomyces cerevisiae YHR148W IMP3 Component of the SSU processome OS=Geotrichum candidum GN=BN980_GECA07s04146g PE=4 SV=1
A0A167FVP5_9ASCO64.67%1841e-86Imp3p OS=Sugiyamaella lignohabitans GN=IMP3 PE=4 SV=1
A0A060T3L8_BLAAD64.48%1832e-86ARAD1A16918p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A16918g PE=4 SV=1
IMP3_YEAST60.99%1823e-79U3 small nucleolar ribonucleoprotein protein IMP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP3 PE=1 SV=1
UniRef50_P3289960.99%1828e-76U3 small nucleolar ribonucleoprotein protein IMP3 n=427 Tax=Eukaryota TaxID=2759 RepID=IMP3_YEAST
A0A1E3PF03_9ASCO56.59%1823e-75U3 small nucleolar ribonucleo protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_75429 PE=4 SV=1
A0A1D8PRP4_CANAL61.08%1673e-73SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR00460CA PE=4 SV=1
Q6C1C9_YARLI53.85%1823e-69YALI0F17380p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F17380g PE=4 SV=1
A0A1E4TBY4_9ASCO24.48%1431e-08Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3855 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1438

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 160 184

Detailed signature matches

    1. PF00163 (Ribosomal_S4)
    2. SM01390 (Ribosomal_...)
    1. SM00363 (s4_6)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF55174 (Alpha-L R...)

Residue annotation

  1. RNA binding surfac...

Protein sequence

>MCA_03065_1
MTRKLKFHEQKLLKKVDFHDWEQDKNHQENTITQRYHLTNRNDYSKYHKLCGEIRKFALKLAELDPRDPVRNKHEQLLLQ
KLQDMGVLLPTKKPKISDLETQMTVSRFCKRRLPVVMWRLKMAPSIRDATMFVEQGHVRIGPQVITDPGFLVTVKMEDYL
TWVDESKIKRNIAKYRQEVDDFLL

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003723 RNA binding
GO:0019843 rRNA binding

Cellular Component

GO:0005622 intracellular