Protein

MCA_03048_1

Length
303 amino acids


Gene name: RPL5

Description: 60S ribosomal protein L5

Browser: contigB:3188466-3189378+

RNA-seq: read pairs 61907, FPKM 2516.2, percentile rank 98.1% (100% = highest expression)

Protein function

Annotation:RPL560S ribosomal protein L5
KEGG:K02932RP-L5e large subunit ribosomal protein L5e
EGGNOG:0PH7ARPL560S ribosomal protein L5
SGD closest match:S000006052RPL560S ribosomal protein L5
CGD closest match:CAL0000178607RPL5Ribosomal 60S subunit protein L5

Protein alignments

%idAln lengthE-value
MIA_00194_188.28%2568e-147MIA_00194_1
A0A167C311_9ASCO82.14%2522e-135Ribosomal 60S subunit protein L5 OS=Sugiyamaella lignohabitans GN=RPL5 PE=3 SV=1
A0A0J9YHB7_GEOCN80.86%2563e-132Similar to Saccharomyces cerevisiae YPL131W RPL5 Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins OS=Geotrichum candidum GN=BN980_GECA01s02045g PE=3 SV=1
A0A060TBQ4_BLAAD78.97%2529e-128ARAD1D28952p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D28952g PE=3 SV=1
A0A1E3PEK8_9ASCO78.74%2548e-12860S ribosomal protein L5 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_28990 PE=3 SV=1
A0A1E4TF93_9ASCO72.91%2514e-121Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2174 PE=3 SV=1
Q6C4Z8_YARLI76.56%2561e-120YALI0E22352p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E22352g PE=3 SV=1
RL5_YEAST72.27%2564e-11560S ribosomal protein L5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL5 PE=1 SV=4
UniRef50_P2632172.27%2569e-11260S ribosomal protein L5 n=160 Tax=Eukaryota TaxID=2759 RepID=RL5_YEAST
Q5AGZ7_CANAL75.78%2565e-112Ribosomal 60S subunit protein L5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL5 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2908
Predicted cleavage: 25

Protein family membership

Domains and repeats

1 50 100 150 200 250 303

Detailed signature matches

    1. PF17144 (Ribosomal_L5e)
    2. PR00058 (RIBOSOMALL5)
    3. MF_01337_A (Ribosom...)
    1. PF14204 (Ribosomal_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF53137 (Translati...)
  2. cd00432 (Ribosomal_...)

Residue annotation

  1. L21e interface cd0...
  2. 23S rRNA interface...
  3. L27 interface cd00...
  4. 5S rRNA interface ...
  5. L5 interface cd00432

Protein sequence

>MCA_03048_1
MAFHPEIKTPAYHSRFQVPFRRRREGKTDYYARKRLVVQSKAKYNSPKYRLVVRFSKKDITAQIVSSQISGDVVFTAAYA
HELPRYGIKHGLTNWAAGYAVGLLVARRALQKLKLDETYTGDEDASGEFSITEAVEDAPRPFKVFLDVGVARTTTGAKIF
GVLKGASDGGLLVPHSAKRYPGFDIETEELDDETLRKYIVAGHVAEYMEELMDDDEERYRTLFKGYIEDGIEADALEDIY
TEAHEKIRADPSPKITEKKDKEYYKAQKKNQKQKKLTLAERKARIAEKAAKLIAERDAAEDEE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome