Protein

MCA_03005_1

Length
440 amino acids


Gene name: CDC3

Description: Cell division control protein 3; septin

Browser: contigB:3060338-3062100+

RNA-seq: read pairs 2444, FPKM 68.5, percentile rank 72.1% (100% = highest expression)

Protein function

Annotation:CDC3Cell division control protein 3; septin
KEGG:K16944SEPT7 septin 7
EGGNOG:0PGWYCell division control protein
SGD closest match:S000004306CDC3Cell division control protein 3
CGD closest match:CAL0000192358CDC3Septin

Protein alignments

%idAln lengthE-value
MIA_02481_185.68%4400.0MIA_02481_1
A0A0J9XH88_GEOCN80.54%4420.0Similar to Saccharomyces cerevisiae YLR314C CDC3 Component of the septin ring of the mother-bud neck that is required for cytokinesis OS=Geotrichum candidum GN=BN980_GECA16s01968g PE=3 SV=1
A0A060TF99_BLAAD67.69%4580.0ARAD1D21428p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D21428g PE=3 SV=1
Q6C816_YARLI71.89%4340.0YALI0D23595p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D23595g PE=3 SV=1
A0A170QZ06_9ASCO71.10%4360.0Septin CDC3 OS=Sugiyamaella lignohabitans GN=CDC3 PE=3 SV=1
UniRef50_V5G5K466.00%4470.0Septin AspB n=122 Tax=Dikarya TaxID=451864 RepID=V5G5K4_BYSSN
A0A1E3PNW1_9ASCO67.44%4330.0Septin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81711 PE=3 SV=1
A0A1D8PD83_CANAL62.33%3691e-151Septin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC3 PE=3 SV=1
A0A1E4TI81_9ASCO52.25%4232e-134Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_70907 PE=3 SV=1
CDC3_YEAST50.12%4232e-129Cell division control protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC3 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0328

Protein family membership

Domains and repeats

1 50 100 150 200 250 300 350 400 440

Detailed signature matches

    1. cd01850 (CDC_Septin)
    2. PIRSF006698 (Septin)
    1. SSF52540 (P-loop co...)
    1. PF00735 (Septin)
    2. PS51719 (G_SEPTIN)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. G1 box cd01850
  2. GTP/Mg2+ binding s...
  3. Switch I region cd...
  4. G2 box cd01850
  5. G3 box cd01850
  6. Switch II region c...
  7. G4 box cd01850
  8. G5 box cd01850

Protein sequence

>MCA_03005_1
MTSVDVSIEPSTMAPIRVESPLDYSLPITTVSSSYPEAKIVKKELKSFVGFANLPNQWHKKSIKKGFNLNVMVVGESGLG
KSTLISTLFNRPLYPAKTPKDPAAEIPKTVAIETVTADIEENFVRLHLTVIDTPGFGDFVNNTDSWKPIIDDIDQRFDAY
LEVENKVNRTQIVDNRVHACLYFIQPTGHSLKALDVTVMKKLHKKVNLIPVIAKSDTLTEEEIKAFKQSILTDINNQKIE
IFEPPKYDNDDEETKLENEELMNHVPFAIVGSTEEVATKDGERVRGRSYPWGVIEVENETHCDFVKLRQLLIRSHLEELR
EKTANVLYENYRTERLAAMGIKQDTSVFREVNPAMRQEEERALQEARLAKMEADMKAVFQKKVAEKEQKLKKSEAELFAR
HREMKEQLEKQRLELEEKKARLEAGRAVEEKKGRKGFSLR

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005525 GTP binding

Cellular Component

None predicted.