Protein
MCA_02997_1
Length
117 amino acids
Gene name: MRP2
Description: 37S ribosomal protein MRP2, mitochondrial
Browser: contigB:3033506-3033936+
RNA-seq: read pairs 2885, FPKM 302.1, percentile rank 91.8% (100% = highest expression)
Protein function
Annotation: | MRP2 | 37S ribosomal protein MRP2, mitochondrial | |
---|---|---|---|
KEGG: | K02954 | RP-S14 | small subunit ribosomal protein S14 |
EGGNOG: | 0PP96 | MRP2 | mitochondrial 37S ribosomal protein MRP2 |
SGD closest match: | S000006370 | MRP2 | 37S ribosomal protein MRP2, mitochondrial |
CGD closest match: | CAL0000191348 | MRP2 | Mitochondrial 37S ribosomal protein MRP2 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_02527_1 | 82.91% | 117 | 4e-69 | MIA_02527_1 |
A0A0J9XK78_GEOCN | 77.78% | 117 | 9e-66 | Similar to Saccharomyces cerevisiae YPR166C MRP2 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA26s00065g PE=4 SV=1 |
A0A060T8M5_BLAAD | 63.25% | 117 | 1e-50 | ARAD1D04664p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D04664g PE=4 SV=1 |
UniRef50_A0A0P1KZC6 | 61.40% | 114 | 4e-42 | LAQU0S20e01332g1_1 n=2 Tax=Lachancea TaxID=300275 RepID=A0A0P1KZC6_9SACH |
RT02_YEAST | 58.77% | 114 | 2e-43 | 37S ribosomal protein MRP2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP2 PE=1 SV=1 |
Q5AJZ7_CANAL | 54.70% | 117 | 9e-40 | Mitochondrial 37S ribosomal protein MRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRP2 PE=4 SV=1 |
A0A1E3PSS2_9ASCO | 59.18% | 98 | 1e-36 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81428 PE=4 SV=1 |
A0A1E4TLV0_9ASCO | 53.92% | 102 | 5e-36 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_19213 PE=4 SV=1 |
Q6C892_YARLI | 40.62% | 96 | 4e-19 | YALI0D21626p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D21626g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1981
Protein family membership
- Ribosomal protein S14 (IPR001209)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
SSF57716 (Glucocort...)
Protein sequence
>MCA_02997_1 MPPRFPGFTKAHVPGGVFPKTRMVRDNFKRAKVAENEVTRTALRYISRNTTLPGAARIAAQLQLNAMPNYTRPTQIKNRC VESGYARSVISEFRLCRMQFRDKALSGELPGVKKGSW
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome