Protein

MCA_02984_1

Length
284 amino acids

Gene name: COX11

Description: Cytochrome c oxidase assembly protein COX11, mitochondrial

Browser: contigB:3007733-3008588+

RNA-seq: read pairs 4116, FPKM 178.4, percentile rank 86.7% (100% = highest expression)

Protein function

Annotation:COX11Cytochrome c oxidase assembly protein COX11, mitochondrial
KEGG:K02258COX11 cytochrome c oxidase assembly protein subunit 11
EGGNOG:0PG5SCOX11Cytochrome c oxidase assembly protein
SGD closest match:S000006053COX11Cytochrome c oxidase assembly protein COX11, mitochondrial
CGD closest match:CAL0000182913COX11Cox11p

Protein alignments

%idAln lengthE-value
A0A0J9X5F5_GEOCN76.82%2201e-128Similar to Saccharomyces cerevisiae YPL132W COX11 Mitochondrial inner membrane protein required for delivery of copper to the Cox1p subunit of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA03s04971g PE=3 SV=1
MIA_02540_177.78%2254e-128MIA_02540_1
A0A1E3PDS5_9ASCO65.12%2155e-101Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84505 PE=3 SV=1
UniRef50_W0T8W665.70%2072e-91CtaG_Cox11 super family n=28 Tax=saccharomyceta TaxID=716545 RepID=W0T8W6_KLUMA
COX11_YEAST62.21%2171e-93Cytochrome c oxidase assembly protein COX11, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX11 PE=3 SV=2
A0A167DTB2_9ASCO64.14%1986e-94Cox11p OS=Sugiyamaella lignohabitans GN=COX11 PE=3 SV=1
Q6C6F0_YARLI53.36%2233e-86YALI0E10065p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10065g PE=3 SV=1
Q59PA0_CANAL58.29%1992e-84Cox11p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX11 PE=3 SV=1
A0A060TGD0_BLAAD53.36%2537e-82ARAD1D29128p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D29128g PE=3 SV=1
A0A1E4TEA0_9ASCO52.40%2082e-75Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25710 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9868
Predicted cleavage: 24

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 284

Detailed signature matches

  1. Family IPR007533
    Cytochrome c oxidase assembly protein CtaG/Cox11
    1. PF04442 (CtaG_Cox11)
    2. MF_00155 (CtaG)
  2. Domain IPR023471
    Cytochrome c oxidase assembly protein CtaG/Cox11, domain
    1. SSF110111 (Ctag/Cox11)
    2. G3DSA:2.60.37...
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. Coil
  3. NON_CYTOPLASM... (N...)
  4. TMhelix
  5. TRANSMEMBRANE (Tran...)
  6. mobidb-lite (disord...)

Protein sequence

>MCA_02984_1
MFQYIRSSVNLPSRKLAQSFANSKLMANKRSFKSFSFPKFEAANPNSKPKLTREQYQEIANQIRLERNRRGVQTGAYWAG
SVIVLFLTLSYAAVPLYRIVCQQSGFMGSPVAADPSKFTADKLVPVDYKRRIRVAFSGNTSTTMPWKFTPQQREVKVLPG
ETALAFYKAKNPTDRDIIGMATYSVVPEKAAPYFSKIQCFCFEEQKLAAGEEVDMPVFFFIDPDFASDPMMRNVDDIILN
YTFFQARYDDNGVLVPIQHPDSDKKPNGKLITEPVESLQSQPSA

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005507 copper ion binding

Cellular Component

None predicted.