Protein

MCA_02893_1

Length
80 amino acids

Description: putative centromere protein W

Browser: contigB:2665542-2665874-

RNA-seq: read pairs 490, FPKM 74.7, percentile rank 74.0% (100% = highest expression)

Protein function

Annotation:putative centromere protein W

Protein alignments

%idAln lengthE-value
UniRef50_A0A1E3Q4V533.80%716e-08Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3Q4V5_LIPST
MIA_03456_136.92%654e-09MIA_03456_1
A0A0J9XFF1_GEOCN32.39%719e-09Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA12s00169g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8717
Predicted cleavage: 22

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 80

Detailed signature matches

  1. Family IPR028847
    Centromere protein W
    1. PF15510 (CENP-W)
  2. Domain IPR009072
    Histone-fold
    1. SSF47113 (Histone-fold)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.20.10

Protein sequence

>MCA_02893_1
MKNNKPATYPHRSIARSIKKNQPECRLSKKAVPLVYLDCLLFLEQVLRQSHTDVSIQGGKTITKKQIEIYGKKVLKQFKQ

GO term prediction

Biological Process

GO:0000278 mitotic cell cycle
GO:0051382 kinetochore assembly

Molecular Function

GO:0003677 DNA binding
GO:0046982 protein heterodimerization activity

Cellular Component

None predicted.