Protein
MCA_02818_1
Length
110 amino acids
Gene name: MRPL31
Description: 54S ribosomal protein L31, mitochondrial
Browser: contigB:2450780-2451297+
RNA-seq: read pairs 1101, FPKM 122.6, percentile rank 82.1% (100% = highest expression)
Protein function
| Annotation: | MRPL31 | 54S ribosomal protein L31, mitochondrial | |
|---|---|---|---|
| EGGNOG: | 0PPS8 | FG05489.1 | mitochondrial 54S ribosomal protein YmL31 |
| SGD closest match: | S000001621 | MRPL31 | 54S ribosomal protein L31, mitochondrial |
| CGD closest match: | CAL0000174313 | orf19.1485 | 54S ribosomal protein L31, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XDX1_GEOCN | 73.64% | 110 | 3e-53 | 54S ribosomal protein L31, mitochondrial OS=Geotrichum candidum GN=BN980_GECA11s01770g PE=4 SV=1 |
| MIA_01807_1 | 69.09% | 110 | 3e-51 | MIA_01807_1 |
| A0A1E3PQW0_9ASCO | 57.66% | 111 | 3e-36 | 54S ribosomal protein L31, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44548 PE=4 SV=1 |
| A0A060TBT4_BLAAD | 53.64% | 110 | 3e-34 | ARAD1D37378p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D37378g PE=4 SV=1 |
| UniRef50_B2VQM7 | 50.91% | 110 | 1e-24 | 54S ribosomal protein L31, mitochondrial n=16 Tax=Fungi TaxID=4751 RepID=B2VQM7_PYRTR |
| RM31_YEAST | 45.04% | 131 | 5e-25 | 54S ribosomal protein L31, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL31 PE=1 SV=1 |
| A0A1E4TMS8_9ASCO | 45.16% | 93 | 7e-18 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23278 PE=4 SV=1 |
| Q6C7C6_YARLI | 41.35% | 104 | 2e-16 | 54S ribosomal protein L31, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E01914g PE=4 SV=1 |
| Q5ALU1_CANAL | 40.00% | 105 | 4e-14 | 54S ribosomal protein L31, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1485 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8864
Predicted cleavage: 36
Protein family membership
- Ribosomal protein L31, mitochondrial (IPR016340)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF09784 (L31)
-
PIRSF002216 (MRPL31)
-
Protein sequence
>MCA_02818_1 MFGPFRSTMTVMGGLLWKNPHTMSRHQKQRLRRRLRTVDSVLETLKAGLDKLNFKSTTLEKVIAATPKESEMSPKDKYWV FNKKSKGYRKSAHLQPKWTRITNRVPPKNF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.