Protein

MCA_02804_1

Length
363 amino acids

Gene name: MPG1

Description: Mannose-1-phosphate guanyltransferase

Browser: contigB:2423538-2424630+

RNA-seq: read pairs 3002, FPKM 101.9, percentile rank 79.0% (100% = highest expression)

Protein function

Annotation:MPG1Mannose-1-phosphate guanyltransferase
KEGG:K00966GMPP mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
EGGNOG:0PFAHMPG1Involved in cell wall synthesis where it is required for glycosylation. Involved in cell cycle progression through cell- size checkpoint
SGD closest match:S000002213PSA1Mannose-1-phosphate guanyltransferase
CGD closest match:CAL0000178573MPG1Mannose-1-phosphate guanyltransferase

Protein alignments

%idAln lengthE-value
MIA_00993_194.49%3630.0MIA_00993_1
A0A0J9X5B8_GEOCN93.39%3630.0Similar to Saccharomyces cerevisiae YDL055C PSA1 GDP-mannose pyrophosphorylase (Mannose-1-phosphate guanyltransferase) OS=Geotrichum candidum GN=BN980_GECA03s00241g PE=4 SV=1
A0A167FSY7_9ASCO91.74%3630.0Mannose-1-phosphate guanylyltransferase OS=Sugiyamaella lignohabitans GN=PSA1 PE=4 SV=1
A0A060TBX4_BLAAD88.15%3630.0ARAD1D31350p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D31350g PE=4 SV=1
MPG1_YARLI86.23%3630.0Mannose-1-phosphate guanyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MPG1 PE=3 SV=1
A0A1E3PMK8_9ASCO82.64%3630.0Mannose-1-phosphate guanyltransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83018 PE=4 SV=1
A0A1E4TDB8_9ASCO79.40%3640.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32918 PE=4 SV=1
MPG1_CANAL79.95%3640.0Mannose-1-phosphate guanyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MPG1 PE=1 SV=1
UniRef50_O9382779.95%3640.0Mannose-1-phosphate guanyltransferase n=274 Tax=Eukaryota TaxID=2759 RepID=MPG1_CANAL
MPG1_YEAST77.47%3640.0Mannose-1-phosphate guanyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSA1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5029
Predicted cleavage: 25

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Repeat
1 50 100 150 200 250 300 363

Detailed signature matches

  1. Domain IPR029044
    Nucleotide-diphospho-sugar transferases
    1. G3DSA:3.90.55...
    2. SSF53448 (Nucleotid...)
  2. Domain IPR005835
    Nucleotidyl transferase domain
    1. PF00483 (NTP_transf...)
  3. Domain IPR011004
    Trimeric LpxA-like
    1. SSF51161 (Trimeric ...)
  4. Repeat IPR001451
    Hexapeptide repeat
    1. PF00132 (Hexapep)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:2.160.1...
  2. cd06425 (M1P_guanyl...)

Residue annotation

  1. probable substrate...
  2. metal binding site...

Protein sequence

>MCA_02804_1
MKGLILVGGYGTRLRPLTLTIPKPLVEFGNRPMILHQVESLAAAGVKDIVLAVNYRPEVMVSTLKKYEEEYGVNITFSVE
TEPLGTAGPLKLAEEILKKDDSPFFVLNSDIICDYPFAELAKFHKAHGGEGTIVATKVEEPSKYGVIVHKANSSQIDRFV
EKPVEFVGNRINAGIYILNPSVIDLIELRPTSIEKETFPQLCSKGTLHSFDLEGYWMDVGQPKDFLSGTCLYLTSLAKKN
SSMLTATSEPYVQGGNVLVDPTAKISPDAKIGPNVVIGPNVTVGAGARLSRSVVLANSNIKPHAYVKNSIIGWNSTVGRW
ARVENISVLGDDVEVKDEVYVNGGRVLPHKTIAGNVEKPEIIM

GO term prediction

Biological Process

GO:0009058 biosynthetic process

Molecular Function

GO:0016779 nucleotidyltransferase activity

Cellular Component

None predicted.