Protein
MCA_02803_1
Length
270 amino acids
Gene name: RPL7A
Description: 60S ribosomal protein L7
Browser: contigB:2418906-2419719+
RNA-seq: read pairs 1391, FPKM 63.4, percentile rank 70.5% (100% = highest expression)
Protein function
| Annotation: | RPL7A | 60S ribosomal protein L7 | |
|---|---|---|---|
| KEGG: | K02937 | RP-L7e | large subunit ribosomal protein L7e |
| EGGNOG: | 0PGRR | RPL7 | 60S ribosomal protein L7 |
| SGD closest match: | S000006119 | RPL7B | 60S ribosomal protein L7-B |
| CGD closest match: | CAL0000182421 | orf19.2478.1 | Ribosomal 60S subunit protein L7A |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00992_1 | 64.79% | 267 | 8e-107 | MIA_00992_1 |
| A0A161HMA2_9ASCO | 50.19% | 259 | 2e-77 | Ribosomal 60S subunit protein L7B OS=Sugiyamaella lignohabitans GN=RPL7B PE=4 SV=1 |
| A0A0J9X3G2_GEOCN | 49.61% | 254 | 3e-75 | Similar to Saccharomyces cerevisiae YPL198W RPL7B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA01s03123g PE=4 SV=1 |
| RL7_YARLI | 49.61% | 258 | 2e-74 | 60S ribosomal protein L7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL7 PE=3 SV=1 |
| A0A060T863_BLAAD | 49.00% | 249 | 2e-74 | ARAD1C33990p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C33990g PE=4 SV=1 |
| A0A1E4TM20_9ASCO | 53.92% | 204 | 6e-70 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1370 PE=4 SV=1 |
| A0A1E3PLY9_9ASCO | 45.38% | 260 | 4e-64 | 60S ribosomal protein L7 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50369 PE=4 SV=1 |
| UniRef50_S3E8I1 | 47.18% | 248 | 2e-52 | Ribosomal protein L30p/L7e n=4 Tax=sordariomyceta TaxID=715989 RepID=S3E8I1_GLAL2 |
| RL7B_YEAST | 42.44% | 205 | 3e-51 | 60S ribosomal protein L7-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL7B PE=1 SV=3 |
| A0A1D8PDL6_CANAL | 41.95% | 205 | 3e-50 | Ribosomal 60S subunit protein L7A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2478.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1929
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
200
270
Detailed signature matches
no IPR
Unintegrated signatures
-
-
cd01657 (Ribosomal_...)
-
mobidb-lite (disord...)
Residue annotation
-
23S rRNA binding s...
-
5S rRNA binding si...
Protein sequence
>MCA_02803_1 MGIKHTKKVNPSTKPAHTKPNDLVPTETLLKKRKNADSHKQKLAREEQAKKKAAKIAEKKKKHASIFKRAETFVKDYRLT EQEHARFENAFSEPSKIEVPSEPKLLFVMRINNPQRKLIPQAKLILKAFRITQVYSGVFLMLNEATAELLRVIEPFVAFG YPSLNSVRTLINKRANIKNPSGEKGTVTLTDNSVIEDALGKYGIICVEDLIHEIYTLGPHFKEATYFLVPFQLSSPTGGW GVRAKFSKFIEGEGLGEKAYDINAIIEAQN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.