Protein

MCA_02766_1

Length
146 amino acids


Browser: contigB:2316046-2316798-

RNA-seq: read pairs 40913, FPKM 3438.9, percentile rank 98.8% (100% = highest expression)

Protein function

KEGG:K02951RP-S12e small subunit ribosomal protein S12e
EGGNOG:0PN3MFG07292.140S ribosomal protein S12
SGD closest match:S000005896RPS1240S ribosomal protein S12
CGD closest match:CAL0000200890RPS1240S ribosomal protein S12

Protein alignments

%idAln lengthE-value
MIA_01997_177.24%1232e-66MIA_01997_1
A0A0J9X9V0_GEOCN70.73%1231e-6040S ribosomal protein S12 OS=Geotrichum candidum GN=BN980_GECA07s00802g PE=3 SV=1
Q5ADQ6_CANAL64.71%1198e-5040S ribosomal protein S12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS12 PE=3 SV=1
Q6C2P6_YARLI64.71%1191e-4940S ribosomal protein S12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F06160g PE=3 SV=1
UniRef50_A0A0E9NFY161.48%1223e-4140S ribosomal protein S12 n=3 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NFY1_9ASCO
A0A060T2W7_BLAAD56.45%1241e-4740S ribosomal protein S12 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A11682g PE=3 SV=1
A0A1E3PGY3_9ASCO66.67%1207e-4640S ribosomal protein S12 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83529 PE=3 SV=1
A0A1E4TB13_9ASCO57.85%1211e-4340S ribosomal protein S12 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_132319 PE=3 SV=1
RS12_YEAST52.89%1212e-3640S ribosomal protein S12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS12 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0357

Protein family membership

Domains and repeats

1 20 40 60 80 100 120 146

Detailed signature matches

    1. PR00972 (RIBSOMALS12E)
    2. PS01189 (RIBOSOMAL_...)
    1. SSF55315 (L30e-like)
    1. PF01248 (Ribosomal_...)

Protein sequence

>MCA_02766_1
MLTTSDVEEVQVEEVAVESTQPSELSLEDALKSALSIALRHNGLARGLKSASKALTTRNAVMCVLCDSVTEESYIKLVEG
LCSEGNVNIPLIKVSDAKKLGEWVGLAQLDREGNPRKIVGCGVAVITNWGEDSAARQALLKHFETL

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome