Protein

MCA_02735_1

Length
542 amino acids

Gene name: DBP3

Description: ATP-dependent RNA helicase DBP3

Browser: contigB:2215489-2217118-

RNA-seq: read pairs 2495, FPKM 56.8, percentile rank 68.1% (100% = highest expression)

Protein function

Annotation:DBP3ATP-dependent RNA helicase DBP3
KEGG:K14811DBP3 ATP-dependent RNA helicase DBP3 [EC:3.6.4.13]
EGGNOG:0PGQUDBP3ATP-dependent RNA helicase required for 60S ribosomal subunit synthesis. Involved in efficient pre-rRNA processing, predominantly at site A3, which is necessary for the normal formation of 25S and 5.8S rRNAs (By similarity)
SGD closest match:S000003046DBP3ATP-dependent RNA helicase DBP3
CGD closest match:CAL0000185988DBP3ATP-dependent RNA helicase DBP3

Protein alignments

%idAln lengthE-value
MIA_04581_180.59%4430.0MIA_04581_1
A0A0J9XB87_GEOCN75.75%4660.0Similar to Saccharomyces cerevisiae YGL078C DBP3 Putative ATP-dependent RNA helicase of the DEAD-box family involved in ribosomal biogenesis OS=Geotrichum candidum GN=BN980_GECA06s04586g PE=3 SV=1
A0A167C0C1_9ASCO72.60%4380.0RNA-dependent ATPase DBP3 OS=Sugiyamaella lignohabitans GN=DBP3 PE=3 SV=1
UniRef50_A0A167C0C172.60%4380.0RNA-dependent ATPase DBP3 n=10 Tax=Fungi TaxID=4751 RepID=A0A167C0C1_9ASCO
A0A060T1R6_BLAAD71.21%4480.0ARAD1C26818p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C26818g PE=3 SV=1
A0A1E3PQE7_9ASCO70.86%4530.0DEAD-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49955 PE=3 SV=1
DBP3_YARLI69.61%4410.0ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1
DBP3_YEAST64.58%4630.0ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2
DBP3_CANAL65.07%4380.0ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1
A0A1E4TFW5_9ASCO61.09%4420.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_44241 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0098

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 450 500 542

Detailed signature matches

  1. Domain IPR014014
    RNA helicase, DEAD-box type, Q motif
    1. PS51195 (Q_MOTIF)
  2. Domain IPR014001
    Helicase superfamily 1/2, ATP-binding domain
    1. PS51192 (HELICASE_A...)
    2. SM00487 (ultradead3)
  3. Domain IPR011545
    DEAD/DEAH box helicase domain
    1. PF00270 (DEAD)
  4. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  5. Domain IPR001650
    Helicase, C-terminal
    1. PS51194 (HELICASE_CTER)
    2. SM00490 (helicmild6)
    3. PF00271 (Helicase_C)
  6. SITE IPR000629
    ATP-dependent RNA helicase DEAD-box, conserved site
    1. PS00039 (DEAD_ATP_H...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...
  3. cd00079 (HELICc)
  4. cd00268 (DEADc)
  5. mobidb-lite (disord...)

Residue annotation

  1. ATP binding site c...
  2. Mg++ binding site ...
  3. motif III cd00268
  4. nucleotide binding...
  5. ATP-binding site c...

Protein sequence

>MCA_02735_1
MSAEEEVLNKKRVLDSEEESHTKSKKSKHEKKDKKEKKDKKHKHDKKEKKSSKDKEGKHDKKHKKEKKEKSKESKEEEPA
VESTKAETPVAETKSTTAQPSQKEIDAFLKENTIAIDDPDKTNTAPCMSFDQVTVDNRILKVVSRFPKPSPIQAASWPFL
FAGRDVVGVAETGSGKTFAFAVPALHHLLTVSPKKSGVRVLVVSPTRELAMQIFDSMTELTKVVNMKAVCIYGGVPKDPQ
RQALKTASIVVATPGRLNDLILEGAADITSVDFLVLDEADRMLEKGFEEDIKTIIGATGSKPENRQTLMFTATWPPQVRE
LAASYMKKNTVRINIGETDELAANKRITQLVEVIEPFKKEQRLIQLLREYQSGSKKNDKILIFALYKKEASRVERFLQMK
GYKVAAIHGDLSQQQRTQALEEFKSGKSKILLATDVAARGLDIPAVKVVINLTFPLTAEDYVHRIGRTGRAGQTGTAYTL
FTEHEKHLSGALINVLKGANQPVPDELLKFGSHTKKKEHSVYGAFYKDIDPNVKAKKITFDD

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0005524 ATP binding

Cellular Component

None predicted.