Protein

MCA_02695_1

Length
332 amino acids

Gene name: SEC14

Description: SEC14 cytosolic factor

Browser: contigB:2075987-2077367-

RNA-seq: read pairs 6880, FPKM 255.3, percentile rank 90.6% (100% = highest expression)

Protein function

Annotation:SEC14SEC14 cytosolic factor
EGGNOG:0PG4QSEC14SEC14 cytosolic factor
SGD closest match:S000004684SEC14SEC14 cytosolic factor
CGD closest match:CAL0000199482SEC14SEC14 cytosolic factor

Protein alignments

%idAln lengthE-value
MIA_06142_182.78%3020.0MIA_06142_1
A0A0J9XD16_GEOCN71.91%2997e-164Similar to Saccharomyces cerevisiae YMR079W SEC14 Phosphatidylinositol/phosphatidylcholine transfer protein OS=Geotrichum candidum GN=BN980_GECA10s01715g PE=4 SV=1
A0A1E3PJS3_9ASCO69.09%3179e-164PI/PC TP protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82673 PE=4 SV=1
A0A060SX04_BLAAD70.07%2942e-159ARAD1A00946p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00946g PE=4 SV=1
SEC14_YARLI66.35%3185e-156SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2
UniRef50_P4581666.35%3181e-152SEC14 cytosolic factor n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=SEC14_YARLI
SEC14_CANAL68.47%2955e-152SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1
SEC14_YEAST64.75%2954e-143SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3
A0A1E4TET1_9ASCO64.18%2822e-129Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2014 PE=4 SV=1
A0A167C2I4_9ASCO76.89%2251e-133Phosphatidylinositol/phosphatidylcholine transfer protein SEC14 OS=Sugiyamaella lignohabitans GN=SEC14 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0463

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 332

Detailed signature matches

  1. Family IPR001071
    Cellular retinaldehyde binding/alpha-tocopherol transport
    1. PR00180 (CRETINALDHBP)
  2. Domain IPR011074
    CRAL/TRIO, N-terminal domain
    1. SM01100 (CRAL_TRIO_N_2)
    2. PF03765 (CRAL_TRIO_N)
    3. SSF46938 (CRAL/TRIO...)
  3. Domain IPR001251
    CRAL-TRIO lipid binding domain
    1. PS50191 (CRAL_TRIO)
    2. SM00516 (sec14_4)
    3. cd00170 (SEC14)
    4. PF00650 (CRAL_TRIO)
    5. G3DSA:3.40.52...
    6. SSF52087 (CRAL/TRIO...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. phospholipid bindi...
  2. salt bridge cd00170

Protein sequence

>MCA_02695_1
MSLPNGVSEKEFLASYPSTAAPTAGTGHPGNITPEQQAAMEQLYKELTELGYKDRLDEASLLRFLRARKFNVENAKIMFV
ECEKWREEFGVNTILTDFHYNEKKQVASYYPQYYHKTDKDGRPVYIEQLGSVKIKEMYKITTEERMLKNLVWEYEAFTTY
RLPACSRQQGHLVETSCTILDLKGISITTASQVYGYIQKASNIGQNYYPERMGKFYVINAPFGFSTIFNFIKRFLDPVTV
DKIHILGSGYKTELLKQVPPQNLPEKFGGTSKSEGGVELADDGPWRDPQFIGPEGMAPRSSAEEDIVDSNRAPVKVDAET
VQTEEAPAPVAA

GO term prediction

Biological Process

GO:0006810 transport

Molecular Function

GO:0005215 transporter activity

Cellular Component

GO:0005622 intracellular