Protein
MCA_02629_1
Length
110 amino acids
Description: Protein Kre1 family
Browser: contigB:1875645-1876076-
RNA-seq: read pairs 677, FPKM 75.4, percentile rank 74.1% (100% = highest expression)
Protein function
| Annotation: | Protein Kre1 family | ||
|---|---|---|---|
| SGD closest match: | S000005266 | KRE1 | Protein KRE1 |
| CGD closest match: | CAL0000185859 | KRE1 | Protein KRE1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X349_GEOCN | 58.73% | 63 | 4e-17 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA01s08942g PE=4 SV=1 |
| UniRef50_A0A0J9X349 | 58.73% | 63 | 8e-14 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X349_GEOCN |
| MIA_02989_1 | 45.63% | 103 | 6e-15 | MIA_02989_1 |
| A0A1E4TIU5_9ASCO | 56.86% | 51 | 3e-12 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_223 PE=4 SV=1 |
| KRE1_CANAL | 48.48% | 66 | 2e-11 | Protein KRE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=KRE1 PE=3 SV=1 |
| Q6C1P1_YARLI | 43.94% | 66 | 5e-09 | YALI0F14619p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F14619g PE=4 SV=1 |
| KRE1_YEAST | 43.75% | 64 | 8e-09 | Protein KRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE1 PE=1 SV=1 |
| A0A167DYQ9_9ASCO | 39.06% | 64 | 2e-07 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1741 PE=4 SV=1 |
| A0A060TBT8_BLAAD | 42.86% | 49 | 6e-07 | ARAD1D30140p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D30140g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9004
Predicted cleavage: 32
Protein family membership
- Protein Kre1 (IPR031452)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF17056 (KRE1)
-
no IPR
Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
-
Protein sequence
>MCA_02629_1 MKYTLSHLILAFLLMASFATAQVYKSVTTRKTVPSVTTTAKVYPTSVWATQILPNGQTNIFLSQYNPTFSAFYSTIAKPS SGSIGLGTIKGTVGTVKPKSYTTISLNTKN
GO term prediction
Biological Process
GO:0031505 fungal-type cell wall organization
Molecular Function
None predicted.
Cellular Component
None predicted.