Protein
MCA_02499_1
Length
463 amino acids
Gene name: CAF17
Description: Putative transferase CAF17, mitochondrial; in S. cerevisiae involved in incorporating iron-sulfur clusters into proteins
Browser: contigB:1482710-1484102-
RNA-seq: read pairs 2048, FPKM 54.5, percentile rank 67.1% (100% = highest expression)
Protein function
| Annotation: | CAF17 | Putative transferase CAF17, mitochondrial; in S. cerevisiae involved in incorporating iron-sulfur clusters into proteins | |
|---|---|---|---|
| EGGNOG: | 0PKK6 | CAF17 | transferase caf17, mitochondrial |
| SGD closest match: | S000003883 | IBA57 | Putative transferase CAF17, mitochondrial |
| CGD closest match: | CAL0000190751 | CAF17 | Putative transferase CAF17, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02819_1 | 54.95% | 455 | 1e-169 | MIA_02819_1 |
| A0A0J9X431_GEOCN | 54.46% | 415 | 1e-161 | Similar to Saccharomyces cerevisiae YJR122W IBA57 Mitochondrial matrix protein involved in the incorporation of iron-sulfur clusters into mitochondrial aconitase-type proteins OS=Geotrichum candidum GN=BN980_GECA02s03442g PE=4 SV=1 |
| UniRef50_A0A0J9X431 | 54.46% | 415 | 2e-158 | Similar to Saccharomyces cerevisiae YJR122W IBA57 Mitochondrial matrix protein involved in the incorporation of iron-sulfur clusters into mitochondrial aconitase-type proteins n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X431_GEOCN |
| A0A167CTM6_9ASCO | 41.32% | 455 | 2e-90 | Iba57p OS=Sugiyamaella lignohabitans GN=IBA57 PE=4 SV=1 |
| A0A060SW56_BLAAD | 39.19% | 421 | 5e-90 | ARAD1A02288p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A02288g PE=4 SV=1 |
| A0A1E3PGP7_9ASCO | 34.41% | 433 | 5e-75 | Aminomethyltransferase folate-binding domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47234 PE=4 SV=1 |
| CAF17_YARLI | 26.64% | 458 | 3e-34 | Putative transferase CAF17, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CAF17 PE=3 SV=1 |
| A0A1E4TAG5_9ASCO | 28.82% | 406 | 5e-30 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45260 PE=4 SV=1 |
| CAF17_CANAL | 25.71% | 490 | 2e-28 | Putative transferase CAF17, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAF17 PE=3 SV=2 |
| CAF17_YEAST | 24.03% | 491 | 2e-25 | Putative transferase CAF17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IBA57 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9115
Predicted cleavage: 64
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
SSF103025 (Folate-b...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_02499_1 MYLSLNPFRRPSSWSKSIPSFSKRLFSTRLPCLNNNNTSQPPPPSPPPPPPPLRGFTKLTNRSLLAIGGPDSAKFLNGIV TNKIISPEDSAYDDTDPTYVSFLNARGRIIAESFVYPVRENTHFQTLLKPLMSPIKNHHEKITDIEVEYLVDCDSQIVSQ LTNTMKLYKLRALVSFAAVPQGLIDQWAVWDDSVESSEIFPLSNTRDLSLYNAETGSKVEAFSDVRCRDLGMRLLLSEGM TPIDVLSPSFINALEEYPLEETTLDSYKIRRILFGIPEGVDELVPGRSLPLEGCMDYMNGISFDKGCYVGQELTVRSKHH GIIRKRIIPVVFYSPKLVDEQQSIDEDEAEVDLAYDPASPITSVIDTSKYLIGSNILDLTPREKAVTGDSPFAPRKSTTN DMSKSRPVGSIVTCIGNVGLALVRLQEFAAPDARLAISVIDPVAHTPHYIRVRGFQPYWWPEE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.