Protein

MCA_02493_1

Length
155 amino acids


Gene name: IES6

Description: Chromatin-remodeling complex subunit IES6

Browser: contigB:1469787-1470255-

RNA-seq: read pairs 433, FPKM 34.3, percentile rank 56.4% (100% = highest expression)

Protein function

Annotation:IES6Chromatin-remodeling complex subunit IES6
KEGG:K11667INO80C INO80 complex subunit C
EGGNOG:0PS3VIES6INO80 complex subunit
SGD closest match:S000000770IES6Chromatin-remodeling complex subunit IES6
CGD closest match:CAL0000200288orf19.2889Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_06151_160.40%1499e-64MIA_06151_1
A0A0J9XBB6_GEOCN56.74%1413e-53Similar to Saccharomyces cerevisiae YEL044W IES6 Protein that associates with the INO80 chromatin remodeling complex under low-salt conditions OS=Geotrichum candidum GN=BN980_GECA08s04091g PE=4 SV=1
A0A167CRJ9_9ASCO47.22%1442e-41Ies6p OS=Sugiyamaella lignohabitans GN=IES6 PE=4 SV=1
UniRef50_A0A167CRJ947.22%1446e-38Ies6p n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A167CRJ9_9ASCO
A0A060T7N2_BLAAD48.94%1412e-40ARAD1D00836p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D00836g PE=4 SV=1
A0A1E3PTB9_9ASCO45.89%1463e-39Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49302 PE=4 SV=1
IES6_YEAST45.95%1487e-36Chromatin-remodeling complex subunit IES6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IES6 PE=1 SV=1
Q6C4L8_YARLI41.96%1438e-36YALI0E25718p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E25718g PE=4 SV=1
A0A1D8PML5_CANAL40.94%1495e-25Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2889 PE=4 SV=1
A0A1E4TLN3_9ASCO50.00%686e-20Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_18096 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0477

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 155

Detailed signature matches

    1. SM00993 (YL1_C_2)
    2. PF08265 (YL1_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_02493_1
MTAQQVIEVVDLPSLAEMDFNAIPRKFKSPTWKTPSRRHKPARAVISDEQKRLQTIITQYQQEQEQRAAAEGADSTQARS
TPAPSFNSSYQSIESPPSIRPRKWYCDITGLEGKYKSTRHGLRYYNAEVFGIIQNIAPGVDQQYLELRNANVVLK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.