Protein
MCA_02476_1
Length
165 amino acids
Gene name: CTR2
Description: Copper transport protein CTR2; Low-affinity copper transporter of the vacuolar membrane;
Browser: contigB:1418939-1419654+
RNA-seq: read pairs 929, FPKM 60.1, percentile rank 69.3% (100% = highest expression)
Protein function
| Annotation: | CTR2 | Copper transport protein CTR2; Low-affinity copper transporter of the vacuolar membrane; | |
|---|---|---|---|
| KEGG: | K14686 | SLC31A1 | solute carrier family 31 (copper transporter), member 1 |
| EGGNOG: | 0PPMQ | FG07059.1 | ctr copper transporter family protein |
| SGD closest match: | S000001218 | CTR2 | Copper transport protein CTR2 |
| CGD closest match: | CAL0000189658 | CTR2 | Low-affinity Cu transporter |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01539_1 | 52.83% | 159 | 8e-51 | MIA_01539_1 |
| UniRef50_J3NJR6 | 44.19% | 172 | 3e-39 | CTR2 short splice n=59 Tax=leotiomyceta TaxID=716546 RepID=J3NJR6_GAGT3 |
| A0A060T4V9_BLAAD | 48.63% | 146 | 1e-41 | ARAD1C44748p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C44748g PE=4 SV=1 |
| A0A0J9XCD5_GEOCN | 44.83% | 145 | 1e-37 | Similar to Saccharomyces cerevisiae YHR175W CTR2 Putative low-affinity copper transporter of the vacuolar membrane OS=Geotrichum candidum GN=BN980_GECA08s00098g PE=4 SV=1 |
| A0A1D8PEE7_CANAL | 43.67% | 158 | 4e-36 | Low-affinity Cu transporter OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTR2 PE=4 SV=1 |
| A0A1E3PSJ2_9ASCO | 41.10% | 146 | 9e-36 | Ctr-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81360 PE=4 SV=1 |
| A0A1E4TBF0_9ASCO | 43.37% | 166 | 2e-33 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28186 PE=4 SV=1 |
| CTR2_YEAST | 43.45% | 145 | 9e-29 | Copper transport protein CTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR2 PE=1 SV=1 |
| Q6C5R6_YARLI | 37.80% | 127 | 2e-21 | YALI0E15796p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E15796g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0020
Protein family membership
- Ctr copper transporter (IPR007274)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_02476_1 MDHSEHEHHQATTMMDMGDDDDQCSMNMLFNWDTKNLCVVFKWWHIRTTFDAILTLLIVVLLGMGYEYLKFIGNKYDQKN NAILRTSRLLDNPSSTGPQASSSSLYSFKVQRALIYAVQVFYSFFLMLVFMTYNGQLMIAIAFGAFLGNLLWGNSTPAKR DLTCH
GO term prediction
Biological Process
GO:0035434 copper ion transmembrane transport
Molecular Function
GO:0005375 copper ion transmembrane transporter activity
Cellular Component
GO:0016021 integral component of membrane