Protein

MCA_02467_2

Length
123 amino acids


Gene name: NTF2

Description: Nuclear transport factor 2

Browser: contigB:1392144-1392862-

RNA-seq: read pairs 7745, FPKM 771.8, percentile rank 95.9% (100% = highest expression)

Protein function

Annotation:NTF2Nuclear transport factor 2
EGGNOG:0PP3PNTF2nuclear transport factor
SGD closest match:S000000811NTF2Nuclear transport factor 2

Protein alignments

%idAln lengthE-value
A0A060T529_BLAAD61.16%1216e-51ARAD1C08492p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C08492g PE=4 SV=1
A0A1D8PES3_CANAL59.66%1193e-50Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NTF2 PE=4 SV=1
A0A0J9X7V7_GEOCN63.33%1203e-49Similar to Saccharomyces cerevisiae YER009W NTF2 Nuclear envelope protein OS=Geotrichum candidum GN=BN980_GECA04s01022g PE=4 SV=1
UniRef50_J4GUJ958.87%1243e-46Uncharacterized protein n=3 Tax=Agaricomycetes TaxID=155619 RepID=J4GUJ9_9APHY
MIA_03885_161.02%1189e-49MIA_03885_1
NTF2_YEAST57.98%1193e-48Nuclear transport factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTF2 PE=1 SV=2
A0A1E3PE72_9ASCO58.33%1206e-46Nuclear transport factor 2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53462 PE=4 SV=1
NTF2_YARLI54.17%1202e-42Nuclear transport factor 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NTF2 PE=3 SV=1
A0A167E293_9ASCO60.67%894e-35Ntf2p OS=Sugiyamaella lignohabitans GN=NTF2 PE=4 SV=1
A0A1E4TB03_9ASCO44.80%1254e-30Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45402 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0430

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 123

Detailed signature matches

    1. SSF54427 (NTF2-like)
    1. PF02136 (NTF2)
    1. PS50177 (NTF2_DOMAIN)
    2. cd00780 (NTF2)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. TAP/p15 interactio...
  2. dimer interface cd...
  3. RanGDP-NTF2 intera...

Protein sequence

>MCA_02467_2
MSDYTQVAEQFVQFYYNTFDADRAGLKSLYRENSMLTFEGAPTLGADSIIEKLSSLPFSKVKHQVTTFDVQPVSFSNGMI
VMVTGALLVDDETMPQNYSQVFHLVPDNGSFYVFNDVFRLNLG

GO term prediction

Biological Process

GO:0006810 transport

Molecular Function

None predicted.

Cellular Component

GO:0005622 intracellular