Protein

MCA_02456_1

Length
399 amino acids

Gene name: RPT6

Description: 26S proteasome regulatory subunit 8 homolog; ATPase of the 19S regulatory particle of the 26S proteasome

Browser: contigB:1360953-1362153+

RNA-seq: read pairs 5403, FPKM 166.9, percentile rank 86.0% (100% = highest expression)

Protein function

Annotation:RPT626S proteasome regulatory subunit 8 homolog; ATPase of the 19S regulatory particle of the 26S proteasome
KEGG:K03066PSMC5 26S proteasome regulatory subunit T6
EGGNOG:0PJ13RPT626S protease regulatory subunit 8
SGD closest match:S000003016RPT626S proteasome regulatory subunit 8 homolog
CGD closest match:CAL0000174449RPT6Proteasome regulatory particle base subunit

Protein alignments

%idAln lengthE-value
A0A0J9XB82_GEOCN92.46%3980.0Similar to Saccharomyces cerevisiae YGL048C RPT6 One of six ATPases of the 19S regulatory particle of the 26S proteasome OS=Geotrichum candidum GN=BN980_GECA07s05070g PE=3 SV=1
MIA_05812_193.86%3910.0MIA_05812_1
A0A060T3E5_BLAAD91.18%3970.0ARAD1C36740p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C36740g PE=3 SV=1
A0A1E4TJW1_9ASCO89.37%3950.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_81166 PE=3 SV=1
A0A1D8PI93_CANAL85.93%3910.0Proteasome regulatory particle base subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPT6 PE=3 SV=1
Q6C8T1_YARLI86.58%3950.0YALI0D17204p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D17204g PE=3 SV=1
A0A1E3PNL8_9ASCO86.25%4000.026S protease regulatory subunit 8 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82321 PE=3 SV=1
PRS8_YEAST80.90%3980.026S proteasome regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT6 PE=1 SV=4
UniRef50_Q0193980.90%3980.026S proteasome regulatory subunit 8 homolog n=74 Tax=Eukaryota TaxID=2759 RepID=PRS8_YEAST
A0A167F849_9ASCO94.57%3500.0Proteasome regulatory particle base subunit RPT6 OS=Sugiyamaella lignohabitans GN=RPT6 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0588

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 399

Detailed signature matches

  1. Family IPR005937
    26S proteasome regulatory subunit P45-like
    1. TIGR01242
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR003593
    AAA+ ATPase domain
    1. SM00382 (AAA_5)
  4. Domain IPR003959
    ATPase, AAA-type, core
    1. PF00004 (AAA)
  5. SITE IPR003960
    ATPase, AAA-type, conserved site
    1. PS00674 (AAA)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.8.60
  3. G3DSA:1.20.5.340
  4. G3DSA:3.40.50...
  5. cd00009 (AAA)

Residue annotation

  1. Walker A motif cd0...
  2. ATP binding site c...
  3. Walker B motif cd0...
  4. arginine finger cd...

Protein sequence

>MCA_02456_1
MSVLATQSHEHGIGPFYSHKIEEIEFKIKEKEQNLRRLEAQRNTLNAKVRLLKEELQVLQEPGSYVGEVVKVMSKDKVLV
KVHPEGKYVVDIASDIDIKKITPSMRVCLRSDSYKLHQILPNKVDPLVSLMMVEKVPDSTFDMVGGLDKQIKEIKEVIEL
PVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTECKFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIF
MDEIDSIGSSRVEGNSGGDSEVQRTMLELLNQLDGFESSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVEARTD
ILRIHSRSMNLTRGINLRKIAEKMSGSSGAEVKGVCTEAGMYALRERRIHVTQEDFELAVAKVISKNDEGQVSQSKFFK

GO term prediction

Biological Process

GO:0030163 protein catabolic process

Molecular Function

GO:0005524 ATP binding
GO:0016787 hydrolase activity

Cellular Component

GO:0005737 cytoplasm