Protein
MCA_02422_1
Length
106 amino acids
Browser: contigB:1244782-1245103+
RNA-seq: read pairs 136, FPKM 15.7, percentile rank 35.1% (100% = highest expression)
Protein function
| SGD closest match: | S000002765 | CNL1 | Biogenesis of lysosome-related organelles complex 1 subunit CNL1 |
|---|
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05864_1 | 42.45% | 106 | 3e-23 | MIA_05864_1 |
| A0A0J9X2Q0_GEOCN | 50.00% | 92 | 1e-21 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA01s08678g PE=4 SV=1 |
| UniRef50_A0A0J9X2Q0 | 50.00% | 92 | 2e-18 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2Q0_GEOCN |
| Q6C7M3_YARLI | 36.27% | 102 | 5e-16 | YALI0D26928p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D26928g PE=4 SV=2 |
| A0A167D9R4_9ASCO | 36.47% | 85 | 2e-14 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_916 PE=4 SV=1 |
| A0A1E3PPY1_9ASCO | 41.41% | 99 | 8e-14 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49924 PE=4 SV=1 |
| BL1S4_YEAST | 30.00% | 100 | 2e-06 | Biogenesis of lysosome-related organelles complex 1 subunit CNL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNL1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0395
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_02422_1 MDVSSDNDSEDTLGIARLTQDFEVLIDTIAARVESLTSQALQSSKERNLEIQDTSILKADQEIHALKNFLKECDEFELDF LKIQQIGEIVKEFKIRIQQAEKLINS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.