Protein

MCA_02378_1

Length
555 amino acids

Gene name: ELP3

Description: Elongator complex protein 3

Browser: contigB:1104409-1106077-

RNA-seq: read pairs 1008, FPKM 22.4, percentile rank 44.4% (100% = highest expression)

Protein function

Annotation:ELP3Elongator complex protein 3
KEGG:K07739ELP3 elongator complex protein 3 [EC:2.3.1.48]
EGGNOG:0PG0IFG02040.1Elongator complex protein 3
SGD closest match:S000006007ELP3Elongator complex protein 3
CGD closest match:CAL0000193262ELP3Elongator complex protein 3

Protein alignments

%idAln lengthE-value
MIA_00876_194.77%5550.0MIA_00876_1
A0A0J9XIF2_GEOCN93.13%5530.0Elongator complex protein 3 OS=Geotrichum candidum GN=BN980_GECA19s00340g PE=3 SV=1
A0A167CZJ2_9ASCO93.10%5510.0Elongator complex protein 3 OS=Sugiyamaella lignohabitans GN=ELP3 PE=3 SV=1
A0A1D8PKD5_CANAL89.26%5400.0Elongator complex protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ELP3 PE=3 SV=1
A0A060TFA1_BLAAD91.26%5490.0Elongator complex protein 3 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D13970g PE=3 SV=1
ELP3_YEAST86.00%5570.0Elongator complex protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELP3 PE=1 SV=1
A0A1E3PS60_9ASCO90.25%5540.0Elongator complex protein 3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81210 PE=3 SV=1
A0A1E4TLF6_9ASCO87.76%5390.0Elongator complex protein 3 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_87223 PE=3 SV=1
Q6CEV3_YARLI87.05%5560.0Elongator complex protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B12628g PE=3 SV=1
UniRef50_Q5RIC076.05%5470.0Elongator complex protein 3 n=26 Tax=Euteleostomi TaxID=117571 RepID=ELP3_DANRE

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0058

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 100 200 300 400 500 555

Detailed signature matches

  1. Family IPR005910
    Histone acetyltransferase ELP3
    1. PIRSF005669 (HAT_Elp3)
    2. TIGR01211
  2. Domain IPR013785
    Aldolase-type TIM barrel
    1. G3DSA:3.20.20.70
  3. Domain IPR007197
    Radical SAM
    1. PF04055 (Radical_SAM)
  4. Domain IPR006638
    Elongator protein 3/MiaB/NifB
    1. SM00729 (MiaB)
  5. Domain IPR032432
    Radical SAM, C-terminal extension
    1. PF16199 (Radical_SAM_C)
  6. Domain IPR016181
    Acyl-CoA N-acyltransferase
    1. SSF55729 (Acyl-CoA ...)
  7. Domain IPR000182
    GNAT domain
    1. PF00583 (Acetyltran...)
    2. PS51186 (GNAT)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.63...
  2. SFLDG01086 (elongat...)
  3. SSF102114 (Radical ...)
  4. cd01335 (Radical_SAM)

Residue annotation

  1. SFLDG01086
  2. FeS/SAM binding si...

Protein sequence

>MCA_02378_1
MAGKKKGPKGNQHLAPEKERFLQCCADISLELVASLNTNKDINLNGLVNRVSKKYKLKNQPRLTDIISSIPDQYKKYLLP
KLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQ
LRQLGHSIDKVEYIIMGGTFMSLPKDYREDFIANLHNALSGATVKDVDEAVAFSQQSLTKCVGITIETRPDYCTETHLSD
MLKYGCTRLEIGVQSAYEDVARDTNRGHTVKAVCKTFCLAKDAGYKVVSHMMPDLPNVGMERDLDQFQEYFENPAFRTDG
LKLYPTLVIRGTGLYELWKNGLYKSYNANALIDLVARILALVPPWTRIYRVQRDIPMPLVTAGVENGNLRELALARMKDF
GTTCRDVRTREVGIQEVHHKVRPDQVELIRRDYAANDGWETFLSYEDPKQDILIGLLRLRLCSEEHTYRPELTGQRTSLV
RELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIARDEHGSEKISVISGVGVRNYYAKLGYFLDGPYMSKMLV

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003824 catalytic activity
GO:0008080 N-acetyltransferase activity
GO:0051536 iron-sulfur cluster binding

Cellular Component

None predicted.